KEGG   Mus musculus (mouse): 56448Help
Entry
56448             CDS       T01002                                 

Gene name
Cyp2d22, 2D22
Definition
cytochrome P450, family 2, subfamily d, polypeptide 22
Orthology
K07414  
cytochrome P450, family 2, subfamily D [EC:1.14.14.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Steroid hormone biosynthesis
Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    56448 (Cyp2d22)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    56448 (Cyp2d22)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     56448 (Cyp2d22)
Cytochrome P450 [BR:mmu00199]
 Cytochrome P450, animal type
  CYP2 family
   56448 (Cyp2d22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
15 E2; 15
AA seq 500 aa AA seqDB search
MRLPTGAELWPIAIFTVIFLILVNLMHWRQRWTAHYPPGPMPWPVLGNLLHMDFQNMPAG
FQKLRGRYGDLFSLQLASESVVVLNGLTALREALVKHSEDTADRPPLHFNDLLGFGPRSQ
GIVLARYGPAWRQQRRFSVSTMHHFGLGKKSLEQWVTEEARCLCAAFADHTGHPFSPNTL
LDKAVCNVIASLLYACRFEYDDPRFIRLLGLLKETLKEEAGFLPMFLNVFPMLLRIPGLV
GKVFPGKRAFVTMLDELLAEHKTTWDPTQPPRDLTDAFLAEVEKAKGNPESSFNDENLRT
VVGDLFSAGMVTTSTTLSWALMLMILHPDVQRRVQQEIDEVIGQVQCPEMADQARMPYTN
AVIHEVQRFADILPLGVPHKTSRDIELQGFLIPKGTTLITNLSSALKDETVWEKPLCFHP
EHFLDAQGHFVKPEAFMPFSAGRRSCLGEPLARMELFLFFTCLLQRFSISVPDGQPQPSD
HGVFRALTTPCPYQLCALPR
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgagactgccgaccggggctgaactgtggcccatagccatattcacggtcatcttcctg
attctggtgaacctgatgcactggcgccagcgctggactgcccactaccctccaggccct
atgccgtggcctgtgcttgggaacctgctgcacatggacttccagaatatgccagcaggc
ttccaaaagctgcggggtcgctatggggacctgttcagcctacagctggcctctgagtca
gtggttgtactaaatgggctgacggccctgcgagaggcactggtgaaacacagcgaggac
actgctgaccggccaccgctgcatttcaatgacctgctgggctttggaccacgctctcaa
ggtatagtcctagcacggtatgggcctgcctggcgtcagcagcggcgcttctctgtgtct
accatgcaccactttggcctgggcaagaagtcactggagcagtgggtgactgaggaggcc
agatgcctctgtgccgccttcgctgaccatactggacaccctttcagccctaacacccta
ttggacaaagcagtgtgtaacgtgatcgcgtccctcctctatgcctgccgctttgagtac
gatgacccacgcttcatcaggctactgggcttgttgaaggaaactcttaaggaggaagct
ggattcctacccatgttcctgaatgtgttcccgatgctcctgcgcatcccggggctggtt
ggcaaggtcttccctgggaaaagggcctttgttaccatgttggatgagctgctggctgaa
cacaagacgacctgggaccctacccagccaccccgagatttgactgatgccttcctggct
gaggtggagaaggccaaggggaatcctgagagcagcttcaatgatgagaacctgcgcacg
gtagtgggtgacctgttctctgcagggatggtgaccacctcaaccacactgtcctgggcc
ctgatgctcatgatcctgcatccagatgtgcagcgccgagtacaacaggaaatcgatgaa
gtcatagggcaggtgcagtgtccagagatggcagaccaggctcgcatgccctacaccaat
gctgtcattcatgaggtgcagcgctttgcagacattctccctcttggtgtacctcacaag
acttctcgtgacattgaactacagggcttccttatccctaaggggacgaccctcatcacc
aacctgtcctccgcgctaaaagatgagactgtctgggagaagcccctctgcttccatcct
gaacacttcctggatgcccagggccactttgtgaagcctgaggccttcatgccattctca
gcaggccgcagatcatgcctgggggagcccctggcccgcatggagctcttcctcttcttc
acctgcctcctgcagcgctttagcatctcagtgcccgatggacagccccagcccagcgac
catggcgtctttagggctctgacaaccccatgcccctaccagctctgtgctttgccccgc
taa

DBGET integrated database retrieval system