KEGG   Mus musculus (mouse): 56451Help
Entry
56451             CDS       T01002                                 

Gene name
Suclg1, 1500000I01Rik, Sucla1
Definition
(RefSeq) succinate-CoA ligase, GDP-forming, alpha subunit (EC:6.2.1.4 6.2.1.5)
  KO
K01899  
succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
mmu  Mus musculus (mouse)
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    56451 (Suclg1)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    56451 (Suclg1)
   00640 Propanoate metabolism
    56451 (Suclg1)
Enzymes [BR:mmu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     56451 (Suclg1)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     56451 (Suclg1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
6; 6 C3
AA seq 346 aa AA seqDB search
MTATVVAAAATATMVSSSSGLAAARLLSRTFLLQQNGIRHGSYTASRKHIYIDKNTKIIC
QGFTGKQGTFHSQQALEYGTKLVGGTTPGKGGQKHLGLPVFNTVKEAKEKTGATASVIYV
PPPFAAAAINEAIDAEIPLVVCITEGIPQQDMVRVKHRLTRQGTTRLIGPNCPGVINPGE
CKIGIMPGHIHKKGRIGIVSRSGTLTYEAVHQTTQVGLGQSLCIGIGGDPFNGTDFIDCL
EVFLNDPATEGIILIGEIGGHAEENAAAFLKEHNSGPKAKPVVSFIAGITAPPGRRMGHA
GAIIAGGKGGAKEKISALQSAGVVVSMSPAQLGTTIYKEFEKRKML
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcaacagtagttgctgcggctgccactgcaaccatggtctccagcagcagcggc
ctcgccgccgcccgcctgttgtcgcgcaccttcctcctgcaacagaatgggatacgacac
gggtcttacacagcctctcggaaacatatctatattgataaaaatacgaagattatttgc
cagggtttcacaggcaaacagggtacctttcacagtcagcaggctttggagtacggcacc
aaactcgtgggaggaaccactccagggaagggtggccagaagcacctgggcttgcccgtc
tttaatactgtgaaggaagccaaagagaaaacaggagcaacggcttctgtcatctatgtc
cctcctccttttgctgctgctgccattaatgaagcaatcgacgcggagattcccttggtt
gtgtgcattacggaaggtattccgcagcaggatatggtgcgggtcaagcacagactgaca
cgccagggaacgacgaggctaatcgggccaaactgccccggcgtcatcaaccctggagaa
tgcaaaatcggcatcatgcctggccacattcacaagaagggaagaataggtatcgtgtcc
aggtccggtactctgacttatgaagcagttcaccaaacaacccaagtcggattggggcag
tccttgtgtattggcattggaggtgacccttttaatgggactgattttattgattgcctt
gaagtcttcctgaatgatccagccacagaaggcatcatactgattggtgaaattggtggt
cacgctgaagaaaatgctgccgcgtttctgaaggagcataactcaggtccaaaggccaag
cctgtagtgtccttcattgctggtataactgctcctcctggcagaaggatgggccatgca
ggggcaattattgctggaggaaaaggtggcgctaaagagaagatctctgctcttcagagt
gctggggtggttgtcagcatgtcccccgcacagctgggaactaccatttataaggagttt
gaaaagaggaagatgctttga

DBGET integrated database retrieval system