KEGG   Mus musculus (mouse): 56454Help
Entry
56454             CDS       T01002                                 

Gene name
Aldh18a1, 2810433K04Rik, AI429789, Pycs
Definition
aldehyde dehydrogenase 18 family, member A1 (EC:1.2.1.41 2.7.2.11)
Orthology
K12657  
delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
mmu  Mus musculus (mouse)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    56454 (Aldh18a1)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    56454 (Aldh18a1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.41  glutamate-5-semialdehyde dehydrogenase
     56454 (Aldh18a1)
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     56454 (Aldh18a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
19 C3; 19
AA seq 795 aa AA seqDB search
MLRHMHRSGVQPFRQRLLPWVQSIAVPRSNRVQPSAIRHVRSWSNIPFITVPLSRAHGKP
FAHRSELKHAKRIVVKLGSAVVTRGDECGLALGRLASIVEQVSVLQNQGREMMLVTSGAV
AFGKQRLRHEILLSQSVRQALHSGQNHLKEMAIPVLEARACAAAGQSGLMALYEAMFTQY
SICAAQILVTNLDFHDEQKRRNLNGTLHELLRMNIVPIVNTNDAVVPPAEPNSDLQGVNV
ISVKDNDSLAARLAVEMKTDLLIVLSDVEGLFDSPPGSDDAKLIDIFYPGDQQSVTFGTK
SRVGLGGMEAKVKAALWALQGGTSVVIANGTHPKVSGHVITDIVEGKKVGTFFSEVKPAG
PTVEQQGEMARSGGRMLATLEPEQRAEIINHLADLLTDQREEILLANKKDLEEAEGRLAS
PLLKRLSLSTSKLNSLAIGLRQIAASSQESVGRVLRRTRIAKNLELEQVTVPIGVLLVIF
ESRPDCLPQVAALAIASGNGLLLKGGKEAAHSNRILHLLTQEALSIHGVKEAIQLVNTRE
EVEDLCRLDKIIDLIIPRGSSQLVRDIQKAAKGIPVMGHSEGICHMYVDSEASVDKVTRL
VRDSKCEYPAACNALETLLIHRDLLRTPLFDQIIDMLRVEQVKIHAGPKFASYLTFSPSE
VKSLRTEYGDLEVCIEVVDSVQEAIDHIHKYGSSHTDVIVTENEKTAEFFLQHVDSACVF
WNASTRFSDGYRFGLGAEVGISTSRIHARGPVGLEGLLTTKWLLRGQDHVVSDFSEHGSL
KYLHENLPVPQRNFS
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atgctgagacacatgcaccgctctggggtccagcccttcaggcaacgtcttctaccatgg
gtccagtccatagctgtgcccagatcaaatcgtgtccagccctcagctattagacatgtt
cgttcttggagcaacatcccctttatcacggtacccctcagtcgtgcccacggcaagccc
tttgcccaccgaagtgagctgaagcacgccaagagaattgtagtgaaactcggcagtgcc
gtggtgaccagaggagatgagtgtggcctggcactgggacgcctggcatctattgttgaa
caggtctcggtgctgcagaatcagggccgagagatgatgctggtgaccagtggagccgtc
gccttcggcaaacagcgcctgcgccatgagatccttctgtctcagagcgtgcggcaagcc
ctgcactcaggacagaaccatctgaaggagatggcaattccggtcttagaggcccgagcc
tgtgcagctgctggacagagtggactgatggccttgtacgaggccatgtttacacagtac
agcatctgtgctgcccagatcttggtgaccaacctggatttccacgacgagcagaagcgc
agaaatctcaacggtaccctccacgagctgctccgcatgaacatcgtccccatcgtcaac
acaaacgatgccgtcgtccctccagccgagcccaacagtgatcttcagggggtaaatgtg
attagtgttaaggataatgatagcctggctgcccggctggccgtggagatgaaaaccgac
ctcttgattgtcctctcggacgtagaaggcctctttgacagccccccaggctcagatgat
gcaaagctcattgatatattctatccgggagatcagcagtctgtgacatttggaaccaag
tctagagtgggcctagggggcatggaagccaaggtgaaagccgccctctgggctttgcaa
ggcgggacttctgtcgtcattgccaacgggacccacccaaaggtgtctgggcacgtcatc
acagacatcgtggagggaaagaaagttggcaccttcttttcagaagtgaagcctgctggt
cctacagtggagcagcagggggagatggctcgatctggtgggagaatgctggctacctta
gagcctgaacagagagctgaaattatcaatcatctggctgacctgctgacggaccagcgg
gaagagatcctgttagccaacaaaaaagatttggaggaggcagagggaagacttgccagc
cccctgctgaagcgccttagcctctccacgtccaaactgaacagcctggccatcgggctg
cggcagatcgcagcctcctcacaagagagcgtaggccgcgtcctgcgccggactcggatt
gccaaaaacctggagttagaacaagtgactgtcccaataggtgttttactggtgatcttt
gagtctcgccctgactgtctaccccaggtggcagccttggctattgccagtggcaatggc
ttgttgctcaaaggtgggaaggaggccgcacacagcaaccgcattcttcacctcctgacc
caggaggccctctccatccacggagtcaaggaggccatacagctggtaaacaccagagaa
gaagttgaggatctctgccgccttgacaaaataatagatctgatcattccccgaggctcc
tcccagctggtcagagacatccagaaagctgccaaagggatcccagtgatgggccacagc
gaaggcatctgccacatgtacgtggattccgaagccagcgtggacaaggtcacccgactc
gtcagagactctaaatgtgaatacccagccgcctgtaatgccctggagacgttgcttatc
caccgagatctgctgagaacacccttatttgaccagatcattgacatgctccgagtggaa
caggtaaaaattcacgcaggccccaagtttgcctcctacctgaccttcagcccctcagaa
gtgaagtcactccggacggagtacggggacctggaagtgtgcattgaagtggtggacagc
gtccaggaagccattgatcacatccataagtacggcagctctcacacagatgtcatcgtc
acagagaacgagaaaacagcggagttcttcctccagcacgtggacagcgcctgtgtcttc
tggaacgccagtactcgcttctctgatggttaccgctttggactgggagctgaagttgga
atcagcacatctcgaatccacgcccggggaccagtaggacttgagggattgctaactaca
aagtggttgcttcgagggcaagaccacgtggtctcggacttctccgagcatggaagcctc
aagtatcttcacgagaatctccctgttccccagagaaatttcagctga

DBGET integrated database retrieval system