KEGG   Mus musculus (mouse): 56463Help
Entry
56463             CDS       T01002                                 

Gene name
Snd1, AL033314, Tudor-SN
Definition
(RefSeq) staphylococcal nuclease and tudor domain containing 1
  KO
K15979  staphylococcal nuclease domain-containing protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05169  Epstein-Barr virus infection
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    56463 (Snd1)
  Infectious diseases
   05169 Epstein-Barr virus infection
    56463 (Snd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SNase TUDOR Agenet
Motif
Other DBs
NCBI-GeneID: 56463
NCBI-ProteinID: NP_062750
MGI: 1929266
Ensembl: ENSMUSG00000001424
Vega: OTTMUSG00000035791
UniProt: Q78PY7
Position
6; 6 A3.3
AA seq 910 aa AA seqDB search
MASSAQSSGSSGGPAVPTVQRGIVKMVLSGCAIIVRGQPRGGPPPERQINLSNIRAGNLA
RRAAATQPDGKDTPDEPWAFPAREFLRKKLIGKEVCFTIENKTPQGREYGMIYLGKDTNG
ENIAESLVAEGLATRREGMRANNPEQNRLSECEEQAKASKKGMWSEGNGSHTIRDLKYTI
ENPRHFVDSHHQKPVNAIIEHVRDGSVVRALLLPGHHLVTVMLSGIKCPTFRRETDGSET
PEPFAAEAKFFTESRLLQRDVQIILESCHNQNLLGTILHPNGNITELLLKEGFARCVDWS
IAVYTRGAEKLRAAERFAKERRLRIWRDYVPPTANLDQKDKQFVAKVMQVLNADAIVVKL
NSGDYKTIHLSSIRPPRLEGDNIQDKNKKLRPLYDIPYMFEAREFLRKKLIGKKVNVTVD
YIRPASPATETVPAFSERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELL
AAEARAIKNGKGLHSKKEVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRL
KLYLPKETCLITFLLAGIECPRGARNLPGLVQEGEPFSEEATLFTKELVLQREVEVEVES
MDKAGNFIGWLHMDGANLSVLLVEQALSKVHFTAERSAYYKPLLSAEEAAKQRKEKVWAH
YEERPVEEVMPVLEEKERSASYKPVFVTEITDDLHFYVQDVETGTQLEKLMENMRNDISS
HPPVEGSYAPRRGEFCIAKFVDGEWYRARVEKVESPAKVHVFYIDYGNREILPSTRLGTL
PPAFSTRVLPAQATEYAFAFIQVPQDEDARTDAVDSVVRDIQNTQCLLNVEHLSASCPHV
TLQFADSKGDVGLGLVKEGLVMVEVRKEKQFQKVITEYLNAQESAKSARLNLWRYGDFRA
DDADEFGYSR
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atggcctcctccgcgcagagcagcggctcctccgggggacccgcggtccccaccgtgcag
cggggcatcgtcaagatggtcctctctgggtgcgccataattgtccgagggcagccccgg
ggtggtcctcctcctgagaggcagatcaacctcagcaacattcgagctggaaatcttgcc
cgtcgggcagctgccacacaaccagatgggaaggacaccccggatgagccctgggcattt
cctgcccgagagttccttcgcaagaagctgattgggaaagaagtctgtttcacgatagaa
aacaagactccccagggacgagagtatgggatgatctacctaggaaaagatactaatggg
gaaaacattgcagagtcgctagttgcagaaggcttggccacccggagagaaggcatgaga
gccaacaacccagagcagaaccggctttcagaatgcgaggaacaagcaaaggcatcgaag
aaagggatgtggagtgagggcaacggttcacacaccatccgggacctcaagtacaccatt
gagaacccaaggcactttgtggactcacaccaccagaagccagtcaatgctatcattgag
catgttcgagacggcagtgtggtccgggccctgctccttccaggtcaccaccttgtcacc
gtcatgctctcagggattaagtgcccaaccttccgtcgggaaacagatgggagtgaaacg
ccggagcccttcgctgcagaagccaagtttttcaccgagtctcgactgcttcagagagat
gttcagatcattctggagagctgccacaatcagaaccttctgggtaccatcctccacccg
aatggtaacatcactgaactcctcctgaaggaaggttttgcccgctgtgtggactggtca
attgcagtttacacccggggtgcagaaaagctgagggcagctgagaggtttgccaaggag
cgcaggctgagaatatggagagactatgtgcctcccactgctaatttggaccaaaaggac
aagcagttcgttgccaaggtcatgcaggttttgaatgctgatgccattgttgtgaagctg
aattctggagactacaagaccatccacctgtcaagcatccgaccaccaaggttggaggga
gacaacatacaggataagaacaagaagctccggcccctgtatgacatcccctacatgttt
gaggcccgcgaatttcttcgaaaaaagctcattgggaagaaggtcaatgtgactgtggac
tacattagaccagccagcccagccacagaaacggtgcctgccttttccgagcgtacctgt
gccactgtcaccattggaggaataaacattgctgaggccctcgtcagcaaaggcctggcc
acagtgatcagataccggcaggatgacgaccagaggtcttcacactacgatgagctgcta
gctgcagaggccagagctattaagaatggcaaaggattacacagcaagaaggaggtgccc
atccaccgagttgcagacatttctggggacacccagaaagcaaagcagttcctgcccttt
cttcagcgggcaggccgttctgaggctgtggtggagtatgtcttcagtggctctcgcctc
aagctctatttacctaaggagacctgcctcatcaccttcctgctggccggcattgaatgt
cccagaggagcacggaatctcccgggcttggtgcaggaaggagagccattcagcgaggag
gccacacttttcaccaaggaactagtgctgcagcgagaggtggaggtagaggtagagagc
atggataaggctggcaacttcattggctggctgcacatggatggggctaacctgtctgtc
ctgctggtggagcaagcgctgtccaaggtccacttcactgctgagcgcagtgcctactac
aagcctctcctgtctgctgaggaagctgccaagcagaggaaagagaaggtctgggcccac
tatgaggagcggcctgtggaggaggtcatgcctgtgctggaggagaaggagcgctctgcc
agctacaagccggtgtttgtgaccgagatcacagatgacctgcacttctatgtgcaagat
gtggagactggcacccagctggaaaagctgatggagaacatgcgcaatgacatctccagt
caccctcctgttgaggggtcctatgccccccgccggggagagttctgcattgccaaattt
gtagatggagaatggtaccgcgcccgggtagaaaaggtggagtcccctgccaaagtgcat
gtcttctacatcgactacggcaacagagagatcctgccatccacccgcctgggcacccta
ccacctgccttcagcacgcgtgtattgccagctcaagccacagagtatgccttcgccttc
atccaggtgccccaagatgaggacgctcgcacagatgctgtggacagtgtggtgcgggac
atccaaaacactcagtgcctgctcaacgtggagcacctgagcgccagctgcccccatgtc
actctgcagtttgcagattccaagggcgatgtgggactgggcctggtgaaggaagggctg
gtcatggtggaggtgcgcaaggagaagcagttccagaaagtgatcacagaatacctgaat
gcccaggaatcagccaagagtgccaggctgaacctgtggcgctatggagacttccgcgct
gatgacgctgatgagtttggctacagtcgctaa

DBGET integrated database retrieval system