KEGG   Mus musculus (mouse): 56463Help
Entry
56463             CDS       T01002                                 

Gene name
Snd1, AL033314, Tudor-SN
Definition
(RefSeq) staphylococcal nuclease and tudor domain containing 1
  KO
K15979  
staphylococcal nuclease domain-containing protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
Epstein-Barr virus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    56463 (Snd1)
  Infectious diseases
   05169 Epstein-Barr virus infection
    56463 (Snd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
6; 6 A3.3
AA seq 910 aa AA seqDB search
MASSAQSSGSSGGPAVPTVQRGIVKMVLSGCAIIVRGQPRGGPPPERQINLSNIRAGNLA
RRAAATQPDGKDTPDEPWAFPAREFLRKKLIGKEVCFTIENKTPQGREYGMIYLGKDTNG
ENIAESLVAEGLATRREGMRANNPEQNRLSECEEQAKASKKGMWSEGNGSHTIRDLKYTI
ENPRHFVDSHHQKPVNAIIEHVRDGSVVRALLLPGHHLVTVMLSGIKCPTFRRETDGSET
PEPFAAEAKFFTESRLLQRDVQIILESCHNQNLLGTILHPNGNITELLLKEGFARCVDWS
IAVYTRGAEKLRAAERFAKERRLRIWRDYVPPTANLDQKDKQFVAKVMQVLNADAIVVKL
NSGDYKTIHLSSIRPPRLEGDNIQDKNKKLRPLYDIPYMFEAREFLRKKLIGKKVNVTVD
YIRPASPATETVPAFSERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELL
AAEARAIKNGKGLHSKKEVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRL
KLYLPKETCLITFLLAGIECPRGARNLPGLVQEGEPFSEEATLFTKELVLQREVEVEVES
MDKAGNFIGWLHMDGANLSVLLVEQALSKVHFTAERSAYYKPLLSAEEAAKQRKEKVWAH
YEERPVEEVMPVLEEKERSASYKPVFVTEITDDLHFYVQDVETGTQLEKLMENMRNDISS
HPPVEGSYAPRRGEFCIAKFVDGEWYRARVEKVESPAKVHVFYIDYGNREILPSTRLGTL
PPAFSTRVLPAQATEYAFAFIQVPQDEDARTDAVDSVVRDIQNTQCLLNVEHLSASCPHV
TLQFADSKGDVGLGLVKEGLVMVEVRKEKQFQKVITEYLNAQESAKSARLNLWRYGDFRA
DDADEFGYSR
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atggcctcctccgcgcagagcagcggctcctccgggggacccgcggtccccaccgtgcag
cggggcatcgtcaagatggtcctctctgggtgcgccataattgtccgagggcagccccgg
ggtggtcctcctcctgagaggcagatcaacctcagcaacattcgagctggaaatcttgcc
cgtcgggcagctgccacacaaccagatgggaaggacaccccggatgagccctgggcattt
cctgcccgagagttccttcgcaagaagctgattgggaaagaagtctgtttcacgatagaa
aacaagactccccagggacgagagtatgggatgatctacctaggaaaagatactaatggg
gaaaacattgcagagtcgctagttgcagaaggcttggccacccggagagaaggcatgaga
gccaacaacccagagcagaaccggctttcagaatgcgaggaacaagcaaaggcatcgaag
aaagggatgtggagtgagggcaacggttcacacaccatccgggacctcaagtacaccatt
gagaacccaaggcactttgtggactcacaccaccagaagccagtcaatgctatcattgag
catgttcgagacggcagtgtggtccgggccctgctccttccaggtcaccaccttgtcacc
gtcatgctctcagggattaagtgcccaaccttccgtcgggaaacagatgggagtgaaacg
ccggagcccttcgctgcagaagccaagtttttcaccgagtctcgactgcttcagagagat
gttcagatcattctggagagctgccacaatcagaaccttctgggtaccatcctccacccg
aatggtaacatcactgaactcctcctgaaggaaggttttgcccgctgtgtggactggtca
attgcagtttacacccggggtgcagaaaagctgagggcagctgagaggtttgccaaggag
cgcaggctgagaatatggagagactatgtgcctcccactgctaatttggaccaaaaggac
aagcagttcgttgccaaggtcatgcaggttttgaatgctgatgccattgttgtgaagctg
aattctggagactacaagaccatccacctgtcaagcatccgaccaccaaggttggaggga
gacaacatacaggataagaacaagaagctccggcccctgtatgacatcccctacatgttt
gaggcccgcgaatttcttcgaaaaaagctcattgggaagaaggtcaatgtgactgtggac
tacattagaccagccagcccagccacagaaacggtgcctgccttttccgagcgtacctgt
gccactgtcaccattggaggaataaacattgctgaggccctcgtcagcaaaggcctggcc
acagtgatcagataccggcaggatgacgaccagaggtcttcacactacgatgagctgcta
gctgcagaggccagagctattaagaatggcaaaggattacacagcaagaaggaggtgccc
atccaccgagttgcagacatttctggggacacccagaaagcaaagcagttcctgcccttt
cttcagcgggcaggccgttctgaggctgtggtggagtatgtcttcagtggctctcgcctc
aagctctatttacctaaggagacctgcctcatcaccttcctgctggccggcattgaatgt
cccagaggagcacggaatctcccgggcttggtgcaggaaggagagccattcagcgaggag
gccacacttttcaccaaggaactagtgctgcagcgagaggtggaggtagaggtagagagc
atggataaggctggcaacttcattggctggctgcacatggatggggctaacctgtctgtc
ctgctggtggagcaagcgctgtccaaggtccacttcactgctgagcgcagtgcctactac
aagcctctcctgtctgctgaggaagctgccaagcagaggaaagagaaggtctgggcccac
tatgaggagcggcctgtggaggaggtcatgcctgtgctggaggagaaggagcgctctgcc
agctacaagccggtgtttgtgaccgagatcacagatgacctgcacttctatgtgcaagat
gtggagactggcacccagctggaaaagctgatggagaacatgcgcaatgacatctccagt
caccctcctgttgaggggtcctatgccccccgccggggagagttctgcattgccaaattt
gtagatggagaatggtaccgcgcccgggtagaaaaggtggagtcccctgccaaagtgcat
gtcttctacatcgactacggcaacagagagatcctgccatccacccgcctgggcacccta
ccacctgccttcagcacgcgtgtattgccagctcaagccacagagtatgccttcgccttc
atccaggtgccccaagatgaggacgctcgcacagatgctgtggacagtgtggtgcgggac
atccaaaacactcagtgcctgctcaacgtggagcacctgagcgccagctgcccccatgtc
actctgcagtttgcagattccaagggcgatgtgggactgggcctggtgaaggaagggctg
gtcatggtggaggtgcgcaaggagaagcagttccagaaagtgatcacagaatacctgaat
gcccaggaatcagccaagagtgccaggctgaacctgtggcgctatggagacttccgcgct
gatgacgctgatgagtttggctacagtcgctaa

DBGET integrated database retrieval system