KEGG   Mus musculus (mouse): 56480Help
Entry
56480             CDS       T01002                                 

Gene name
Tbk1, 1200008B05Rik, AI462036, AW048562
Definition
(RefSeq) TANK-binding kinase 1
  KO
K05410  TANK-binding kinase 1 [EC:2.7.11.10]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04014  Ras signaling pathway
mmu04137  Mitophagy - animal
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu04657  IL-17 signaling pathway
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi's sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex infection
mmu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    56480 (Tbk1)
 Cellular Processes
  Transport and catabolism
   04137 Mitophagy - animal
    56480 (Tbk1)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    56480 (Tbk1)
   04621 NOD-like receptor signaling pathway
    56480 (Tbk1)
   04622 RIG-I-like receptor signaling pathway
    56480 (Tbk1)
   04623 Cytosolic DNA-sensing pathway
    56480 (Tbk1)
   04657 IL-17 signaling pathway
    56480 (Tbk1)
 Human Diseases
  Infectious diseases
   05162 Measles
    56480 (Tbk1)
   05164 Influenza A
    56480 (Tbk1)
   05161 Hepatitis B
    56480 (Tbk1)
   05160 Hepatitis C
    56480 (Tbk1)
   05168 Herpes simplex infection
    56480 (Tbk1)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    56480 (Tbk1)
   05169 Epstein-Barr virus infection
    56480 (Tbk1)
   05165 Human papillomavirus infection
    56480 (Tbk1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     56480 (Tbk1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   56480 (Tbk1)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Xenophagy
   Other xenophagy associated proteins
    56480 (Tbk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like CEP63 DUF713 ubiquitin ALIX_LYPXL_bnd
Motif
Other DBs
NCBI-GeneID: 56480
NCBI-ProteinID: NP_062760
MGI: 1929658
Ensembl: ENSMUSG00000020115
UniProt: Q9WUN2 A1L361
Structure
PDB: 

Jmol
Position
10; 10 D2
AA seq 729 aa AA seqDB search
MQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLYAVKVFNNISFLRPVDVQMREFEVLK
KLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVV
GGMNHLRENGIVHRDIKPGNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEYL
HPDMYERAVLRKDHQKKYGATVDLWSVGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITG
KPSGAISGVQKAENGPIDWSGDMPLSCSLSQGLQALLTPVLANILEADQEKCWGFDQFFA
ETSDVLHRMVIHVFSLQHMTAHKIYIHSYNTAAVFHELVYKQTKIVSSNQELIYEGRRLV
LELGRLAQHFPKTTEENPIFVTSREQLNTVGLRYEKISLPKIHPRYDLDGDASMAKAVTG
VVCYACRTASTLLLYQELMRKGVRWLVELVKDDYNETVHKKTEVVITLDFCIRNIEKTVK
VYEKLMKVNLEAAELGEISDIHTKLLRLSSSQGTIESSLQDISSRLSPGGLLADTWAHQE
GTHPRDRNVEKLQVLLNCITEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMSH
FSEECVRKYEAFKDKSEEWMRKMLHLRKQLLSLTNQCFDIEEEVSKYQDYTNELQETLPQ
KMLAASGGVKHAMAPIYPSSNTLVEMTLGMKKLKEEMEGVVKELAENNHILERFGSLTMD
GGLRNVDCL
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgcagagcacctccaaccatctgtggctcctgtctgatatcctaggccagggggccact
gcaaatgtcttccgaggaaggcataagaaaactggtgatctctatgctgtcaaagtattt
aataacataagcttccttcgcccagtggatgttcaaatgagagaatttgaagtgttaaaa
aaactcaatcacaaaaacattgtcaagttatttgctattgaagaggagacaacaacaaga
cataaagtgcttattatggagttttgtccctgtgggagtttatacactgttctagaggag
ccgtccaatgcgtatggacttccagaatcagaatttctcattgtcttacgagatgtggtg
ggcgggatgaatcatctccgagagaacggcatagtgcaccgagatatcaagccaggcaac
atcatgcgcgtcataggggaggacggccagtctgtgtacaaactcacggatttcggcgcc
gctcgagagctggaggacgatgagcagtttgtgtctctgtacggcacagaagagtacctg
catccggacatgtatgaaagggcagtgctaagaaaggaccatcagaagaagtacggggct
accgttgatctgtggagtgttggagtgacattctaccatgcagccacggggtcgctgccg
tttagacccttcgaggggcctcggaggaacaaagaagtaatgtataaaataatcactggg
aagccgtctggtgcaatatctggagtacagaaagcagaaaacggaccaattgactggagt
ggagacatgcctctctcctgtagtctttctcagggtcttcaggcactgcttaccccagtt
cttgcaaacatacttgaagctgatcaggagaagtgctggggttttgaccagttctttgca
gagaccagtgatgtgcttcaccgaatggtgatccatgtcttctcgctacaacacatgacg
gcgcataagatttacattcacagctataacactgctgctgtgttccatgaactggtctat
aaacaaaccaagattgtttcctcaaatcaagaacttatctacgaaggacgacgcttagtc
ctagaactcggacgactagcccagcattttcctaaaaccacagaggaaaatcctatcttt
gtcacgagccgggaacaactcaataccgtaggactgagatatgaaaaaatttccctccct
aaaatacatccacgctatgatctggatggggacgccagcatggccaaggcagtgacgggg
gttgtgtgctacgcctgcagaactgccagtaccctgctgctctatcaagaattaatgcga
aagggggtacggtggctggttgaactggttaaggatgattacaacgagaccgtccacaag
aagacggaggtagtgatcacactggatttctgcatcaggaacattgagaagactgtgaaa
gtgtatgagaagttgatgaaggtcaacctggaagccgcagagctgggtgagatttcagac
atacacaccaagctgctgagactttccagttctcagggaacaatagaaagcagtcttcag
gacatcagcagcaggctgtctccagggggcttgctggccgacacctgggcacatcaagaa
ggcacgcatccaagagacaggaatgtagaaaaactgcaggtcctgttgaactgcatcaca
gagatttactatcagttcaaaaaagacaaagcagaacgcagactagcttataatgaagaa
cagatccacaaatttgataagcaaaaattgtattaccatgccacaaaagcaatgagccac
ttctcagaagaatgtgttagaaagtatgaagcgtttaaagataagtcggaagagtggatg
agaaagatgcttcatcttaggaagcagctgttatcgctaactaatcagtgtttcgatatc
gaagaggaagtgtccaagtatcaagactatactaacgagttacaagaaactctgcctcag
aaaatgctcgcagcctccggcggcgtcaagcacgccatggccccgatctaccccagctct
aacaccttagtggagatgactcttggtatgaagaagttaaaggaggagatggaaggcgtg
gttaaggagctggccgagaacaatcatattttagaaaggtttgggtctttaacaatggat
ggtggccttcgcaatgtggactgtctttag

DBGET integrated database retrieval system