KEGG   Mus musculus (mouse): 56480Help
Entry
56480             CDS       T01002                                 

Gene name
Tbk1, 1200008B05Rik, AI462036, AW048562
Definition
(RefSeq) TANK-binding kinase 1 (EC:2.7.11.1)
  KO
K05410  
TANK-binding kinase 1 [EC:2.7.11.10]
Organism
mmu  Mus musculus (mouse)
Pathway
Ras signaling pathway
Toll-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
Hepatitis C
Hepatitis B
Measles
Influenza A
Herpes simplex infection
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    56480 (Tbk1)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    56480 (Tbk1)
   04622 RIG-I-like receptor signaling pathway
    56480 (Tbk1)
   04623 Cytosolic DNA-sensing pathway
    56480 (Tbk1)
 Human Diseases
  Infectious diseases
   05162 Measles
    56480 (Tbk1)
   05164 Influenza A
    56480 (Tbk1)
   05161 Hepatitis B
    56480 (Tbk1)
   05160 Hepatitis C
    56480 (Tbk1)
   05168 Herpes simplex infection
    56480 (Tbk1)
   05169 Epstein-Barr virus infection
    56480 (Tbk1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     56480 (Tbk1)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: Other group
  IKK family [OT]
   56480 (Tbk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
10; 10 D2
AA seq 729 aa AA seqDB search
MQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLYAVKVFNNISFLRPVDVQMREFEVLK
KLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVV
GGMNHLRENGIVHRDIKPGNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEYL
HPDMYERAVLRKDHQKKYGATVDLWSVGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITG
KPSGAISGVQKAENGPIDWSGDMPLSCSLSQGLQALLTPVLANILEADQEKCWGFDQFFA
ETSDVLHRMVIHVFSLQHMTAHKIYIHSYNTAAVFHELVYKQTKIVSSNQELIYEGRRLV
LELGRLAQHFPKTTEENPIFVTSREQLNTVGLRYEKISLPKIHPRYDLDGDASMAKAVTG
VVCYACRTASTLLLYQELMRKGVRWLVELVKDDYNETVHKKTEVVITLDFCIRNIEKTVK
VYEKLMKVNLEAAELGEISDIHTKLLRLSSSQGTIESSLQDISSRLSPGGLLADTWAHQE
GTHPRDRNVEKLQVLLNCITEIYYQFKKDKAERRLAYNEEQIHKFDKQKLYYHATKAMSH
FSEECVRKYEAFKDKSEEWMRKMLHLRKQLLSLTNQCFDIEEEVSKYQDYTNELQETLPQ
KMLAASGGVKHAMAPIYPSSNTLVEMTLGMKKLKEEMEGVVKELAENNHILERFGSLTMD
GGLRNVDCL
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgcagagcacctccaaccatctgtggctcctgtctgatatcctaggccagggggccact
gcaaatgtcttccgaggaaggcataagaaaactggtgatctctatgctgtcaaagtattt
aataacataagcttccttcgcccagtggatgttcaaatgagagaatttgaagtgttaaaa
aaactcaatcacaaaaacattgtcaagttatttgctattgaagaggagacaacaacaaga
cataaagtgcttattatggagttttgtccctgtgggagtttatacactgttctagaggag
ccgtccaatgcgtatggacttccagaatcagaatttctcattgtcttacgagatgtggtg
ggcgggatgaatcatctccgagagaacggcatagtgcaccgagatatcaagccaggcaac
atcatgcgcgtcataggggaggacggccagtctgtgtacaaactcacggatttcggcgcc
gctcgagagctggaggacgatgagcagtttgtgtctctgtacggcacagaagagtacctg
catccggacatgtatgaaagggcagtgctaagaaaggaccatcagaagaagtacggggct
accgttgatctgtggagtgttggagtgacattctaccatgcagccacggggtcgctgccg
tttagacccttcgaggggcctcggaggaacaaagaagtaatgtataaaataatcactggg
aagccgtctggtgcaatatctggagtacagaaagcagaaaacggaccaattgactggagt
ggagacatgcctctctcctgtagtctttctcagggtcttcaggcactgcttaccccagtt
cttgcaaacatacttgaagctgatcaggagaagtgctggggttttgaccagttctttgca
gagaccagtgatgtgcttcaccgaatggtgatccatgtcttctcgctacaacacatgacg
gcgcataagatttacattcacagctataacactgctgctgtgttccatgaactggtctat
aaacaaaccaagattgtttcctcaaatcaagaacttatctacgaaggacgacgcttagtc
ctagaactcggacgactagcccagcattttcctaaaaccacagaggaaaatcctatcttt
gtcacgagccgggaacaactcaataccgtaggactgagatatgaaaaaatttccctccct
aaaatacatccacgctatgatctggatggggacgccagcatggccaaggcagtgacgggg
gttgtgtgctacgcctgcagaactgccagtaccctgctgctctatcaagaattaatgcga
aagggggtacggtggctggttgaactggttaaggatgattacaacgagaccgtccacaag
aagacggaggtagtgatcacactggatttctgcatcaggaacattgagaagactgtgaaa
gtgtatgagaagttgatgaaggtcaacctggaagccgcagagctgggtgagatttcagac
atacacaccaagctgctgagactttccagttctcagggaacaatagaaagcagtcttcag
gacatcagcagcaggctgtctccagggggcttgctggccgacacctgggcacatcaagaa
ggcacgcatccaagagacaggaatgtagaaaaactgcaggtcctgttgaactgcatcaca
gagatttactatcagttcaaaaaagacaaagcagaacgcagactagcttataatgaagaa
cagatccacaaatttgataagcaaaaattgtattaccatgccacaaaagcaatgagccac
ttctcagaagaatgtgttagaaagtatgaagcgtttaaagataagtcggaagagtggatg
agaaagatgcttcatcttaggaagcagctgttatcgctaactaatcagtgtttcgatatc
gaagaggaagtgtccaagtatcaagactatactaacgagttacaagaaactctgcctcag
aaaatgctcgcagcctccggcggcgtcaagcacgccatggccccgatctaccccagctct
aacaccttagtggagatgactcttggtatgaagaagttaaaggaggagatggaaggcgtg
gttaaggagctggccgagaacaatcatattttagaaaggtttgggtctttaacaatggat
ggtggccttcgcaatgtggactgtctttag

DBGET integrated database retrieval system