KEGG   Mus musculus (mouse): 56486Help
Entry
56486             CDS       T01002                                 

Gene name
Gabarap
Definition
(RefSeq) gamma-aminobutyric acid receptor associated protein
  KO
K08341  
GABA(A) receptor-associated protein
Organism
mmu  Mus musculus (mouse)
Pathway
FoxO signaling pathway
Regulation of autophagy
GABAergic synapse
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    56486 (Gabarap)
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    56486 (Gabarap)
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    56486 (Gabarap)
Ubiquitin system [BR:mmu04121]
 Ubiquitins and Ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   56486 (Gabarap)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    56486 (Gabarap)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 42.95 cM; 11 B4
AA seq 117 aa AA seqDB search
MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF
YFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcgtgtacaaagaggagcatccgttcgagaagcgccgctctgagggcgagaaa
atccgaaagaaatacccagaccgggtcccggtgatagtggaaaaagcccccaaagctcgg
ataggagacctggacaaaaagaaatacctggtgccttctgatcttacagttggtcaattc
tacttcttgatccggaagcgaattcatctccgtgctgaagatgccttgtttttctttgtc
aacaatgtcattccacccaccagtgccacgatgggtcagctgtaccaggaacaccatgaa
gaagacttctttctatacattgcctacagtgatgaaagcgtctatggtctgtga

DBGET integrated database retrieval system