KEGG   Mus musculus (mouse): 56486Help
Entry
56486             CDS       T01002                                 

Gene name
Gabarap
Definition
(RefSeq) gamma-aminobutyric acid receptor associated protein
  KO
K08341  GABA(A) receptor-associated protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04068  FoxO signaling pathway
mmu04136  Autophagy - other
mmu04137  Mitophagy - animal
mmu04140  Autophagy - animal
mmu04371  Apelin signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04727  GABAergic synapse
mmu05167  Kaposi's sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    56486 (Gabarap)
   04068 FoxO signaling pathway
    56486 (Gabarap)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    56486 (Gabarap)
   04136 Autophagy - other eukaryotes
    56486 (Gabarap)
   04137 Mitophagy - animal
    56486 (Gabarap)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    56486 (Gabarap)
  Nervous system
   04727 GABAergic synapse
    56486 (Gabarap)
 Human Diseases
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    56486 (Gabarap)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    56486 (Gabarap)
Ubiquitin system [BR:mmu04121]
 Ubiquitins and Ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   56486 (Gabarap)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    56486 (Gabarap)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Atg8 APG12
Motif
Other DBs
NCBI-GeneID: 56486
NCBI-ProteinID: NP_062723
MGI: 1861742
Ensembl: ENSMUSG00000018567
Vega: OTTMUSG00000006020
UniProt: Q9DCD6
Position
11 B3; 11 42.95 cM
AA seq 117 aa AA seqDB search
MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF
YFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcgtgtacaaagaggagcatccgttcgagaagcgccgctctgagggcgagaaa
atccgaaagaaatacccagaccgggtcccggtgatagtggaaaaagcccccaaagctcgg
ataggagacctggacaaaaagaaatacctggtgccttctgatcttacagttggtcaattc
tacttcttgatccggaagcgaattcatctccgtgctgaagatgccttgtttttctttgtc
aacaatgtcattccacccaccagtgccacgatgggtcagctgtaccaggaacaccatgaa
gaagacttctttctatacattgcctacagtgatgaaagcgtctatggtctgtga

DBGET integrated database retrieval system