KEGG   Mus musculus (mouse): 56486Help
Entry
56486             CDS       T01002                                 

Gene name
Gabarap
Definition
(RefSeq) gamma-aminobutyric acid receptor associated protein
  KO
K08341  
GABA(A) receptor-associated protein
Organism
mmu  Mus musculus (mouse)
Pathway
FoxO signaling pathway
Autophagy
NOD-like receptor signaling pathway
GABAergic synapse
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    56486 (Gabarap)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy
    56486 (Gabarap)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    56486 (Gabarap)
  Nervous system
   04727 GABAergic synapse
    56486 (Gabarap)
Ubiquitin system [BR:mmu04121]
 Ubiquitins and Ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   56486 (Gabarap)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    56486 (Gabarap)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 42.95 cM; 11 B4
AA seq 117 aa AA seqDB search
MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF
YFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcgtgtacaaagaggagcatccgttcgagaagcgccgctctgagggcgagaaa
atccgaaagaaatacccagaccgggtcccggtgatagtggaaaaagcccccaaagctcgg
ataggagacctggacaaaaagaaatacctggtgccttctgatcttacagttggtcaattc
tacttcttgatccggaagcgaattcatctccgtgctgaagatgccttgtttttctttgtc
aacaatgtcattccacccaccagtgccacgatgggtcagctgtaccaggaacaccatgaa
gaagacttctttctatacattgcctacagtgatgaaagcgtctatggtctgtga

DBGET integrated database retrieval system