KEGG   Mus musculus (mouse): 56494Help
Entry
56494             CDS       T01002                                 

Gene name
Gosr2, 2310032N09Rik, C76855, Gs27, SNARE, membrin
Definition
(RefSeq) golgi SNAP receptor complex member 2
  KO
K08496  
golgi SNAP receptor complex member 2
Organism
mmu  Mus musculus (mouse)
Pathway
SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    56494 (Gosr2)
Membrane trafficking [BR:mmu04131]
 SNARE
  SNAP-25[N] (Qb)
   Bos1 / Membrin
    56494 (Gosr2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 E1; 11 67.43 cM
AA seq 212 aa AA seqDB search
MEPLYQQTNKQVQEIQSHMGRLERADKQSVHLVENEIQASIEQIFSHLERLEILSSKEPL
NRRQNAKLRVDQLKYDVQHLQTALRNFQHRRQVREQQERQRDELLSRTFTTNDSDTTIPM
DESLQFNSSLHNIHHGMDDLIGGGHSILEGLRAQRLTLKGTQKKILDIANMLGLSNTVMR
LIEKRAFQDKYFMIGGMLLTCAVMFLVVQYLT
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggagcccctataccaacaaacgaacaagcaggttcaggagatccagtctcacatggga
cgcctggagagggcagacaagcagtctgtgcacttagtagaaaatgagatccaagcaagc
atagagcaaatattcagccatctggagcgcctggagattttgtcaagcaaggagcccttg
aatagaagacagaatgccaaactccgtgtcgaccagctaaagtatgatgtccagcacttg
cagactgccctcaggaactttcagcaccggcgccaagtcagggagcagcaggagagacag
cgagacgagcttctgtctcgcaccttcaccactaacgactctgacaccaccattcccatg
gatgaatcactgcagtttaactcctccctccacaacattcaccacggcatggatgacctc
attggaggcgggcacagtattctggagggactgagggcccagagactgaccttgaagggg
actcagaagaagatccttgacattgctaacatgctcggcttgtccaacacagtgatgagg
ctgattgagaagcgggccttccaggacaagtacttcatgatcggtgggatgctgctcact
tgtgcagtcatgttcctcgtggtacagtacctgacatga

DBGET integrated database retrieval system