KEGG   Mus musculus (mouse): 56532Help
Entry
56532             CDS       T01002                                 

Gene name
Ripk3, 2610528K09Rik, AW107945, Rip3
Definition
(RefSeq) receptor-interacting serine-threonine kinase 3 (EC:2.7.11.1)
  KO
K08847  
receptor-interacting serine/threonine-protein kinase 3 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Cytosolic DNA-sensing pathway
TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    56532 (Ripk3)
 Organismal Systems
  Immune system
   04623 Cytosolic DNA-sensing pathway
    56532 (Ripk3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     56532 (Ripk3)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: TKL group
  RIPK family [OT]
   56532 (Ripk3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
14; 14 C1
AA seq 486 aa AA seqDB search
MSSVKLWPTGASAVPLVSREELKKLEFVGKGGFGVVFRAHHRTWNHDVAVKIVNSKKISW
EVKAMVNLRNENVLLLLGVTEDLQWDFVSGQALVTRFMENGSLAGLLQPECPRPWPLLCR
LLQEVVLGMCYLHSLNPPLLHRDLKPSNILLDPELHAKLADFGLSTFQGGSQSGSGSGSG
SRDSGGTLAYLDPELLFDVNLKASKASDVYSFGILVWAVLAGREAELVDKTSLIRETVCD
RQSRPPLTELPPGSPETPGLEKLKELMIHCWGSQSENRPSFQDCEPKTNEVYNLVKDKVD
AAVSEVKHYLSQHRSSGRNLSAREPSQRGTEMDCPRETMVSKMLDRLHLEEPSGPVPGKC
PERQAQDTSVGPATPARTSSDPVAGTPQIPHTLPFRGTTPGPVFTETPGPHPQRNQGDGR
HGTPWYPWTPPNPMTGPPALVFNNCSEVQIGNYNSLVAPPRTTASSSAKYDQAQFGRGRG
WQPFHK
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctgtcaagttatggcctactggtgcgtcagcggttcctctggtgagccgtgaa
gaactgaagaagctggagtttgtgggtaaaggagggttcggagtcgtgttccgggcacac
cacagaacatggaaccatgatgtagcagtcaagatcgtgaactcgaagaagatatcctgg
gaggtgaaggctatggttaatcttcgtaatgagaacgttctgctcctgctgggggtcact
gaggacctccagtgggacttcgtgtccgggcaggctctggtgacaagattcatggagaat
ggctccctcgcagggctgctgcaacccgagtgccctcggccctggccactcctctgtcgc
ctgctgcaggaagtggtgctggggatgtgctacctacacagcttgaaccctccgctcctg
caccgggacctcaagccctctaacattctgctggatccagagctccacgccaagctagca
gattttggcctgtccacgtttcagggagggtcccagtcagggtcaggatcaggatcagga
tccagggactctgggggcaccctagcgtacttggacccagagctgttatttgatgtcaac
ctgaaggcttctaaagcgagtgatgtctacagctttgggatcctcgtgtgggcagtgctg
gctggcagagaagctgagttggtagacaagacttcactaatccgggaaacagtgtgtgac
aggcagagtcgtcctccactgacagagctgcctccaggtagccctgagactcccggcttg
gaaaaactgaaggagttaatgattcattgctggggttcccagtccgaaaacaggccatcc
ttccaggactgcgaaccaaaaaccaatgaagtttacaatctggtaaaggacaaggtagat
gctgctgtctccgaggtaaagcattatctgtctcagcacagaagcagcggcagaaacttg
tctgccagagagccaagccaaagaggcacagaaatggattgcccgagggaaaccatggtt
tctaaaatgctggaccgcctgcatttggaggaaccctccggaccagttcctggaaaatgt
cctgagaggcaagcacaggacacatcagttgggcctgccacaccagcaaggacatcttct
gaccccgtggctggcactcctcagattccacatactttacccttcagaggcacaacacct
gggccagtctttactgagactcccggtcctcacccccaaaggaatcagggagatggaaga
cacggcactccttggtatccctggaccccaccgaatccaatgacagggccaccggctctc
gtcttcaacaactgttctgaagtgcagattgggaactacaactccttggtagcaccacca
agaactactgcctcaagttcggccaagtatgaccaagcacagttcggcaggggtaggggc
tggcagcccttccacaagtag

DBGET integrated database retrieval system