KEGG   Mus musculus (mouse): 56542Help
Entry
56542             CDS       T01002                                 

Gene name
Ick, 2210420N10Rik, AI848300, Mrk
Definition
(RefSeq) intestinal cell kinase (EC:2.7.11.22)
  KO
K08828  
intestinal cell (MAK-like) kinase [EC:2.7.11.22]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     56542 (Ick)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: CMGC group
  RCK family [OT]
   56542 (Ick)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
9; 9 E1
AA seq 629 aa AA seqDB search
MNRYTTIKQLGDGTYGSVLLGRSIESGELIAIKKMKRKFYSWEECMNLREVKSLKKLNHA
NIVKLKEVIRENDHLYFIFEYMKENLYQLIKERNKLFPESAIRNIMYQILQGLAFIHKHG
FFHRDLKPENLLCMGPELVKIADFGLAREIRSRPPYTDYVSTRWYRAPEVLLRSTNYSSP
IDIWAVGCIMAEVYTLRPLFPGASEIDTIFKICQVLGTPKKTDWPEGYQLSSAMNFLWPQ
CIPNNLKTLIPNASSEAIQLLRDLLQWDPKKRPTASQALRYPYFQIGHPLGIISKDSGKP
QREVQDKTGPPPYIKPAPPAQAPAKAYTLISSRPSQASQPPQHSVHPYKGDVSRTEQLSH
VQEGKPSPPFFPSLHNKNLQPKILASLEQKNGEIKPKSRRRWGLISRSTKGSDDWADLDD
LDFSPSLTRIDVKNKKRQSDDTLCRFESVLDLKPSESVGTGTTVSTQASSQRRDTPTLQS
SAKQHYLKHSRYLPGINIRNGVLPNPGKDFLPSNSWSSSGLSGKSSGTVSVVSKITSVGS
GSASSSGLTGSYIPSFLKKEIGSVMQRVQLAPLAAPPPGYSSLKAVRPHPGRPFFHTQPR
STPGLIPRPPAAQPVHGRIDWSSKYPSRR
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgaatagatacacaacgatcaagcagcttggggatgggacctacggctctgtcctgctg
gggagaagcattgagtctggagaactgattgccattaaaaaaatgaaaagaaagttttac
tcctgggaagaatgcatgaaccttcgggaggttaagtctttaaagaagcttaatcatgcc
aatatcgtaaagttaaaagaggttatcagggaaaacgaccatctttactttatcttcgag
tacatgaaggaaaacctttaccagctcattaaagaaagaaataagttgtttccagagtct
gctataaggaatataatgtaccagatattgcaaggactggcattcattcacaaacacggt
ttcttccaccgggacttaaaacccgagaacctcctctgcatgggaccagaacttgtgaaa
atcgccgactttggattggctcgagaaatccgatcaagacctccgtacacagactatgtg
tctactagatggtacagggctccagaggtactgctgagatccaccaactacagctccccc
attgacatctgggcggtaggctgcatcatggcggaggtgtacacgctccggccccttttc
cctggggccagtgaaattgacacaattttcaaaatttgccaagtgttgggaacaccaaag
aagactgactggcctgaaggctaccagctgtcaagtgctatgaatttcctctggccccag
tgcatacccaataacttaaagactctaatcccaaatgctagcagcgaagccattcagctc
ctgagagacttgcttcagtgggatcccaagaaacgaccaaccgctagtcaggctcttcga
tatccttacttccagatcggacacccactgggcatcatcagcaaggactcaggaaaacca
cagagagaggtccaggacaagacaggccctcctccttacatcaagccagcccctcctgcc
caggccccggccaaggcatatacgctgatttcttcacgaccaagccaagccagtcagccc
cctcagcattctgtgcacccctacaaaggcgatgtctctaggactgagcagctgagccat
gttcaggagggcaagccaagccctccattcttcccatccctccacaataagaatcttcag
ccaaaaatcctagccagcctggaacagaaaaatggtgaaatcaagccaaagagcaggaga
agatggggtctcatctccaggtcgacaaagggttctgacgactgggccgacttggatgac
ttagacttcagtccctctctcaccaggatagatgtaaaaaacaagaagagacagagtgat
gacaccctctgcaggtttgaaagtgttctggacctgaagccatctgagtcagtgggtaca
ggaaccactgtctccacgcaggcttcctcgcagaggagagacacgccgaccctgcagtcc
tcagcaaagcagcactacttgaagcactctcgctacttgcctggaataaatataagaaat
ggcgtgctcccaaatccaggcaaggactttcttccatcaaattcatggtccagttccggc
ttgtctggaaaatcttcaggaacagtatcagtagtgagcaaaataacttcagttggctca
ggctctgcgagctctagtggactgactggaagctacattccttcctttctgaaaaaggaa
atcggttctgtcatgcagagggttcagctggcgcccctcgcagcccctccccccggctac
tcttccctcaaggccgtgagacctcacccggggaggcctttctttcacacccagcccagg
agcacgcccggcttgatcccccgacctccagctgctcagcctgtgcacggcaggatagac
tggtcttccaagtacccatcccggcggtga

DBGET integrated database retrieval system