KEGG   Mus musculus (mouse): 56613Help
Entry
56613             CDS       T01002                                 

Gene name
Rps6ka4, 1110069D02Rik, 90kDa, AI848992, Msk2, mMSK2
Definition
(RefSeq) ribosomal protein S6 kinase, polypeptide 4 (EC:2.7.11.1)
  KO
K16510  
ribosomal protein S6 kinase alpha-4 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    56613 (Rps6ka4)
   04668 TNF signaling pathway
    56613 (Rps6ka4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     56613 (Rps6ka4)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: AGC group
  RSK family [OT]
   56613 (Rps6ka4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
19; 19 A
AA seq 773 aa AA seqDB search
MGDEDEDEGCAVELQITEANLTGHEEKVSVENFALLKVLGTGAYGKVFLVRKTGGHDAGK
LYAMKVLRKAALVQRAKTQEHTRTERSVLELVRQAPFLVTLHYAFQTDAKLHLILDYVSG
GEMFTHLYQRQYFKEAEVRVYGGEIVLALEHLHKLGIIYRDLKLENVLLDSEGHIVLTDF
GLSKEFLTEEKERTFSFCGTIEYMAPEIIRSKAGHGKAVDWWSLGILLFELLTGASPFTL
EGERNTQAEVSRRILKCSPPFPLRIGPVAQDLLQRLLCKDPKKRLGAGPQGAQEVKSHPF
FQGLDWVALAARKIPAPFRPQIRSELDVGNFAEEFTRLEPVYSPAGSPPPGDPRIFQGYS
FVAPSILFDHNNAVMADVLQAPGAGYRPGRAAVARSAMMQDSPFFQQYELDLREPALGQG
SFSVCRRCRQRQSGQEFAVKILSRRLEENTQREVAALRLCQSHPNVVNLHEVLHDQLHTY
LVLELLRGGELLEHIRKKRLFSESEASQILRSLVSAVSFMHEEAGVVHRDLKPENILYAD
DTPGAPVKIIDFGFARLRPQSPAEPMQTPCFTLQYAAPELLAQQGYDESCDLWSLGVILY
MMLSGQVPFQGASGQGGQSQAAEIMCKIREGRFSLDGEAWQGVSEEAKELVRGLLTVDPA
KRLKLEGLRSSSWLQDGSARSSPPLRTPDVLESSGPAVRSGLNATFMAFNRGKREGFFLK
SVENAPLAKRRKQKLRSAAASRRGSPVPASSGRLPASAAKGTTRRANGPLSPS
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atgggagacgaggatgaggacgagggctgcgccgtggagctgcagatcaccgaagccaac
ctcaccgggcatgaggagaaggtgagcgtggagaacttcgcgctgctcaaggtgctgggc
acgggagcctatgggaaggtgttcctggtgcggaagacgggtgggcacgacgcgggcaag
ctctatgccatgaaggtgctacgcaaggcggcgttggtgcagcgcgcgaagacacaggag
catacccgcaccgaacgctcggtgctggagctggttcgccaagcacccttcctggtcaca
ctgcactacgccttccagacggatgccaagctgcacctcatcctggactacgtgagcggt
ggtgagatgttcactcacctctaccagcgccagtacttcaaggaggctgaggttcgagtg
tatgggggcgagattgtgctggccctggaacacctgcacaagctgggtatcatctaccgg
gacctgaagctggagaacgtcttacttgactcagaaggtcacatcgtccttacagacttt
gggctgagcaaggagttcctgacggaggagaaagagcggaccttctccttctgtggcaca
atcgagtacatggctcccgaaatcatccgaagcaaggctggacatggcaaggctgtggac
tggtggagcctgggtatcctgctcttcgagctgctgacaggggcctcacccttcacactg
gagggagagaggaacactcaggctgaggtgtcccgacggatcttgaagtgctcccctccc
ttccctctccggattgggcctgtggcacaggacctgctacagcggctgctgtgcaaggac
cctaagaagaggttgggcgcaggtccccagggtgcgcaggaagtcaagagtcaccccttc
ttccagggtctggactgggtggctctggctgccagaaagatcccagccccattccggccc
cagatccgctcagagctggatgtggggaattttgcggaggaattcacccggctggagccc
gtctactcccctgcaggcagccctccacctggggaccctcggatctttcagggatactcc
ttcgtggctccgtccatcctctttgaccacaacaatgcagtgatggctgatgtactgcag
gcaccgggtgccggatacaggcccggcagggcagcagttgccaggagtgccatgatgcag
gactcgcctttcttccagcagtacgaactggaccttcgggagccagcgctggggcagggc
agcttctctgtgtgtcggagatgtaggcagcgccagagcggccaggagtttgctgtcaag
atcctcagccgcaggctggaggagaacactcagcgagaggtggctgctcttcgcctgtgc
cagtcacaccccaacgtggtgaatctgcatgaggtgcttcatgaccagctacacacttac
ctggtcctggagttgctgcgaggcggagagctattggaacacatccgcaagaagcggctc
ttcagcgagtcggaggccagccagatccttcggagcctggtttcggccgtgagcttcatg
cacgaggaggcaggcgtggtgcaccgcgacctgaaacccgagaacatcttgtacgcggac
gacactcccggggccccggtgaagatcatcgacttcgggttcgcgcgactgcggccccag
agcccggcagagcccatgcagactccttgcttcacactgcagtacgctgcacccgagctg
ctggcacagcagggctacgatgagtcctgcgatctatggagcctgggtgtcattctgtac
atgatgctgtctggccaggttcccttccaaggggcctccggccagggtggacagagtcag
gcagctgagatcatgtgcaagatccgtgaagggcgcttctccctggacggggaagcctgg
caaggtgtgtcggaggaagccaaggagctggtccgagggctactgacagtcgaccccgcc
aagcggctgaagctggaggggctgcgtagcagctcgtggcttcaggacggcagcgcgcgc
tcctcgcccccgctccgcacgccggatgtgctggagtcctctgggccagctgtgcgttcc
gggctcaatgccactttcatggcgttcaaccgaggcaagcgcgagggcttctttctcaag
agtgtagagaatgcgcctctggccaagaggcgcaagcagaagctccggagcgcggccgcc
tcccgccgaggctccccagtgcctgcctcctccggtcgcctaccagcctctgccgctaag
gggacaactcgccgagccaacggccccttgtccccttcctag

DBGET integrated database retrieval system