KEGG   Mus musculus (mouse): 56637Help
Entry
56637             CDS       T01002                                 

Gene name
Gsk3b, 7330414F15Rik, 8430431H08Rik, C86142, GSK-3, GSK-3beta, GSK3
Definition
glycogen synthase kinase 3 beta (EC:2.7.11.1 2.7.11.26)
Orthology
K03083  
glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
mmu  Mus musculus (mouse)
Pathway
ErbB signaling pathway
Chemokine signaling pathway
Cell cycle
PI3K-Akt signaling pathway
Wnt signaling pathway
Hedgehog signaling pathway
Axon guidance
Hippo signaling pathway
Focal adhesion
T cell receptor signaling pathway
B cell receptor signaling pathway
Neurotrophin signaling pathway
Dopaminergic synapse
Insulin signaling pathway
Melanogenesis
Prolactin signaling pathway
Thyroid hormone signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Hepatitis C
Measles
Influenza A
HTLV-I infection
Epstein-Barr virus infection
Pathways in cancer
Colorectal cancer
Endometrial cancer
Prostate cancer
Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    56637 (Gsk3b)
   04310 Wnt signaling pathway
    56637 (Gsk3b)
   04340 Hedgehog signaling pathway
    56637 (Gsk3b)
   04390 Hippo signaling pathway
    56637 (Gsk3b)
   04151 PI3K-Akt signaling pathway
    56637 (Gsk3b)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    56637 (Gsk3b)
  Cellular commiunity
   04510 Focal adhesion
    56637 (Gsk3b)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    56637 (Gsk3b)
   04662 B cell receptor signaling pathway
    56637 (Gsk3b)
   04062 Chemokine signaling pathway
    56637 (Gsk3b)
  Endocrine system
   04910 Insulin signaling pathway
    56637 (Gsk3b)
   04917 Prolactin signaling pathway
    56637 (Gsk3b)
   04919 Thyroid hormone signaling pathway
    56637 (Gsk3b)
   04916 Melanogenesis
    56637 (Gsk3b)
  Nervous system
   04728 Dopaminergic synapse
    56637 (Gsk3b)
   04722 Neurotrophin signaling pathway
    56637 (Gsk3b)
  Development
   04360 Axon guidance
    56637 (Gsk3b)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    56637 (Gsk3b)
   05210 Colorectal cancer
    56637 (Gsk3b)
   05217 Basal cell carcinoma
    56637 (Gsk3b)
   05215 Prostate cancer
    56637 (Gsk3b)
   05213 Endometrial cancer
    56637 (Gsk3b)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    56637 (Gsk3b)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    56637 (Gsk3b)
  Infectious diseases
   05166 HTLV-I infection
    56637 (Gsk3b)
   05162 Measles
    56637 (Gsk3b)
   05164 Influenza A
    56637 (Gsk3b)
   05160 Hepatitis C
    56637 (Gsk3b)
   05169 Epstein-Barr virus infection
    56637 (Gsk3b)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     56637 (Gsk3b)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: CMGC group
  GSK family [OT]
   56637 (Gsk3b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16; 16 B4
AA seq 420 aa AA seqDB search
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALF
NFTTQELSSNPPLATILIPPHARIQAAASPPANATAASDTNAGDRGQTNNAASASASNST
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgtcggggcgaccgagaaccacctcctttgcggagagctgcaagccagtgcagcagcct
tcagcttttggtagcatgaaagttagcagagataaagatggcagcaaggtaaccacagta
gtggcaactcctggccagggtcctgacaggccacaggaagtcagttatacagacacgaaa
gtgattggaaatggatcatttggtgtggtatatcaagccaaactttgtgattctggagaa
ctggttgccatcaagaaagttctacaggacaagcgatttaagaaccgagagctccagatc
atgagaaagctagaccactgtaacatagtccgactgcggtatttcttctactcgagtggt
gagaagaaagatgaggtctaccttaacctggtgctggactatgttccggagacagtgtac
agagtcgccagacactatagtcgagccaagcagacactccctgtgatctatgtcaagttg
tatatgtatcagctgttcagaagtctagcctatatccattcctttggaatctgccatcga
gacattaaaccacagaacctcttgttggatcctgatacagctgtattaaaactctgtgac
tttggaagtgcaaagcagctggtccgaggagagcccaatgtttcatatatctgttctcgg
tactacagggcaccagagttgatctttggagccactgattacacgtccagtatagatgta
tggtctgcaggctgtgtgttggctgaattgttgctaggacaaccaatatttcctggggac
agtggtgtggatcagttggtggaaataataaaggtcctaggaacaccaacaagggagcaa
attagagaaatgaacccaaattatacagaattcaaattccctcaaatcaaggcacatcct
tggacaaaggtcttccggccccgaactccaccagaggcaattgcactgtgcagccgtctg
ctggagtacacacctaccgcccggctaacaccactggaagcttgtgcacattcatttttc
gatgaattgcgggacccaaatgtcaaactaccaaatgggcgagacacacctgcactcttc
aactttaccactcaagaactgtcaagtaacccccctctggccaccatccttatccctcca
catgctcggattcaggccgctgcttcaccgcctgccaacgccacagcagcctcagatact
aatgctggagaccgtggacagaccaataacgccgcttctgcatcagcttccaactccacc
tga

DBGET integrated database retrieval system