KEGG   Mus musculus (mouse): 56696Help
Entry
56696             CDS       T01002                                 

Gene name
Gpr132, G2a
Definition
(RefSeq) G protein-coupled receptor 132
  KO
K08426  
G protein-coupled receptor 132
Organism
mmu  Mus musculus (mouse)
Brite
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Other
   Putative / unclassified Class A GPCRs
    56696 (Gpr132)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
12; 12 F2
AA seq 382 aa AA seqDB search
MRSEPTNAAGNTTLGVTSVLQSTSVPSSETCHVSYEESRVVLVVVYSAVCLLGLPANCLT
AWLTLLQVLQRNVLAVYLFCLSLCELLYISTVPLWIIYIQNQHKWNLGPQACKVTAYIFF
CNIYISILLLCCISCDRYMAVVYALESRGHRHQRTAVTISACVILLVGLVNYPVFDMKVE
KSFCFEPLRMNSKIAGYHYLRFTFGFAIPLGILAFTNHQIFRSIKLSDSLSAAQKNKVKR
SAIAVVTIFLVCFAPYHVVLLVKAASFSFYQGDMDAVCAFESRLYTVSMVFLCLSTVNSV
ADPIIYVLGTDHSRQEVSRIHTGWKKWSTKTYVTCSKDSEETHLPTELSNTYTFPNPAHP
PGSQPAKLGLLCSPERLPEELC
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagatcagaacctaccaatgcagcaggaaacaccacactgggggttacctccgttctt
cagagcacctcagtaccttcttctgagacctgccacgtctcctacgaggagagcagagtg
gtcctggtggtggtgtacagtgccgtgtgcctgctgggcctaccagccaactgcctgact
gcctggctgacgctgctgcaagtcctgcagaggaacgtgctagccgtctacctgttctgc
ctgtccctctgtgagctgctctacatcagcacggtgccattgtggatcatctacatccag
aatcagcacaaatggaacctgggtccgcaggcctgcaaggtgactgcttacatcttcttc
tgcaacatctacatcagcatcctcttgctctgctgcatttcctgcgaccgctacatggcc
gtggtctatgcactggagagccgaggccaccgccaccagaggactgctgtcaccatttct
gcgtgtgtgattcttcttgttggacttgttaactatccagtgtttgacatgaaggtggag
aagagtttctgctttgagcccctgaggatgaacagcaagatagccggctaccactacctg
cgtttcacctttggctttgccatccctctcggcatcctggcgttcaccaatcaccagatc
ttccggagcatcaaactcagtgacagcctgagcgctgcgcagaagaacaaggtgaagcgc
tccgccatcgcggtcgtcaccatcttcctggtctgctttgctccctaccacgtggtactc
ctcgtcaaagctgccagcttttccttctaccaaggagacatggatgccgtgtgtgccttt
gaaagcagactgtacacagtctctatggtgtttctgtgcctgtctacagtcaacagtgtg
gctgaccccatcatctacgtgctgggtacagaccactctcggcaagaagtgtccagaatc
cacacagggtggaaaaagtggtccacaaagacatatgttacatgctcaaaggactctgag
gagacacacttgcccacagagctttcaaacacatacaccttccccaatcccgcgcaccct
ccaggatcacagccagcgaagctaggtttactgtgctcgccagagagactgcctgaggag
ctctgctaa

DBGET integrated database retrieval system