KEGG   Mus musculus (mouse): 56717Help
Entry
56717             CDS       T01002                                 

Gene name
Mtor, 2610315D21Rik, AI327068, FRAP, FRAP2, Frap1, RAFT1, RAPT1, flat
Definition
mechanistic target of rapamycin (serine/threonine kinase) (EC:2.7.11.1)
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
mmu  Mus musculus (mouse)
Pathway
ErbB signaling pathway
HIF-1 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Insulin signaling pathway
Thyroid hormone signaling pathway
Adipocytokine signaling pathway
Type II diabetes mellitus
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Glioma
Prostate cancer
Acute myeloid leukemia
Class
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:mmu04012]
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:mmu04066]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:mmu04151]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:mmu04150]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:mmu04910]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:mmu04920]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:mmu04919]
Human Diseases; Cancers; Pathways in cancer [PATH:mmu05200]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:mmu05206]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:mmu05205]
Human Diseases; Cancers; Glioma [PATH:mmu05214]
Human Diseases; Cancers; Acute myeloid leukemia [PATH:mmu05221]
Human Diseases; Cancers; Prostate cancer [PATH:mmu05215]
Human Diseases; Endocrine and metabolic diseases; Type II diabetes mellitus [PATH:mmu04930]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4 E1; 4 78.76 cM
AA seq 2549 aa AA seqDB search
MLGTGPAVATASAATSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEES
TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNSTRIGRFANYLRNLLPSSDP
VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP
TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEE
AEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC
KDLMGFGTKPRHITPFTSFQAVQPQQPNALVGLLGYSSPQGLMGFGTSPSPAKSTLVESR
CCRDLMEEKFDQVCQWVLKCRSSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV
LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKTVQVDA
TVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL
KMLSLVLMHKPLRHPGMPKGLAHQLASPGLTTLPEASDVASITLALRTLGSFEFEGHSLT
QFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSIHLISGHAHVVSQTAVQVVADVLSKLL
VVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSS
MNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALI
LKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVA
LWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHK
VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFR
DQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLV
SFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLR
VFMHDNSQGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEVPLPSRKAALETVD
RLTESLDFTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLV
RHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSSQGDALASGPVETGPMKKLHV
STINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNA
AFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGI
VLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAASGVLEYAMKHF
GELEIQATWYEKLHEWEDALVAYDKKMDTNKEDPELMLGRMRCLEALGEWGQLHQQCCEK
WTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLA
QQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
ERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVD
PSRQLDHPLPTAHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHK
QELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEA
VLHYKHQNQARDEKKKLRHASGANITNATTAATTAASAAAATSTEGSNSESEAESNENSP
TPSPLQKKVTEDLSKTLLLYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDVN
EALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVAS
KSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYFG
ERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQA
WDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSL
QVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNL
SIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLTL
MQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRH
PSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRTTC
HTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDG
VELGEPAHKKAGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDDTLD
VPTQVELLIKQATSHENLCQCYIGWCPFW
NT seq 7650 nt NT seq  +upstreamnt  +downstreamnt
atgcttgggacgggtcctgccgtggccaccgccagtgccgccacatctagcaacgtgagc
gtcctgcagcagttcgccagtggactgaagagccggaatgaggagaccagggccaaagca
gccaaggagctccagcactacgtcaccatggagcttcgagagatgagtcaggaggagtct
actcgcttctatgaccagctgaaccatcacatttttgaactggtttccagctcagatgcc
aatgagaggaagggtggcatcttggccatcgccagcctcataggagtggaaggtgggaat
tccaccagaattggcagatttgccaactaccttcgaaacctcctcccctcaagcgatcca
gttgtcatggaaatggcgtccaaggccattggccgcctggcgatggcaggggacactttc
actgctgaatatgtggagtttgaagtgaagcgagccttggagtggctgggtgctgaccga
aatgagggccggagacatgccgctgtcctcgttctccgtgagctggccatcagtgtcccc
accttcttcttccagcaagttcagcccttctttgacaacatttttgtggctgtgtgggac
cccaagcaggccatccgggaaggcgctgtagcggcccttcgtgcctgtctgattctcacc
acgcagcgggaaccaaaggaaatgcagaagcctcagtggtaccggcacacatttgaagaa
gcagagaaaggttttgatgagaccctggccaaagagaagggtatgaatcgagatgatcga
atccacggagccttgctgatcctcaacgagctagttcgtatcagcagcatggagggagag
cgtctgagagaagagatggaggagatcacccagcagcagctggtgcatgacaagtactgc
aaagacctcatgggcttcgggaccaagcctcggcacatcacgcccttcaccagtttccag
gctgtgcagccccagcagccgaacgccttggtgggactgctggggtacagctcccctcaa
ggcctgatgggatttgggacgtcccccagccctgccaagtccactctggtggaaagccgc
tgttgcagagacttgatggaagagaaatttgatcaggtgtgccagtgggtgctgaagtgc
aggagcagcaagaactcgctgatccagatgacaatccttaacctgctgccccgcctggct
gcattccgaccgtccgccttcacagatacccagtacctccaggacaccatgaaccatgtc
ctgagctgtgtcaagaaggagaaggaacggactgcggcgttccaggccctggggctgctt
tctgtggccgtgaggtcggagtttaaggtctacttgccccgtgtacttgacatcatccga
gcagcgcttcctccaaaggactttgcccacaagaggcagaaaaccgtgcaggtggatgcc
accgtattcacgtgcatcagcatgttggcacgagcaatggggccgggcatccagcaggac
atcaaggagctgctggagcccatgttggcagtgggcctgagccccgcgctcactgctgtg
ctctatgacctgagccggcagattccacagctgaagaaagatattcaggacggccttctg
aagatgctgtccctggtccttatgcacaaacccctccggcacccaggcatgcccaaaggc
ctggctcaccagctggcttcccctggtctcaccaccctccctgaggccagcgacgtggcc
agcatcactcttgcccttcgaacccttggcagctttgaatttgaaggccactctctgacc
cagttcgtccgacactgcgcagatcacttcctgaacagcgagcacaaggagatccgcatg
gaagctgctcgcacctgctcccgcctgctcacaccctccatccacctcatcagcggccat
gcccacgtggttagccagactgcagtgcaggtggtggcagatgtgctcagcaagctgctt
gtggttggcataacagatcctgaccctgatatccgctactgtgtcttggcatccctggac
gagcgctttgatgcccacctggcccaggcagaaaacttacaagctctgtttgtggctctg
aatgaccaggtctttgagatccgcgagctggccatctgcactgtgggccgactaagcagc
atgaacccagccttcgtcatgcctttcctgcgcaagatgctcatccagatcctgacagag
ctggagcacagcggcattgggagaatcaaggagcagagcgcccgcatgctggggcacctg
gtgtccaacgccccccggctcatccgcccctacatggagcctatcctgaaggctttaatt
ttgaaactgaaagatccagaccctgacccaaacccgggcgtgatcaataacgtgttggcc
actataggagaactggctcaggtgagcggcctggaaatgcggaagtgggtggacgagctc
tttatcatcatcatggacatgctgcaggactcctccctgctggccaaaaggcaggtggct
ttgtggaccctgggacagttggtggccagcactggctatgtggtggagccctacaggaag
taccccactttgcttgaagtgctgctgaatttcctgaagacggagcagaaccagggcact
cggagagaggctatccgagtgttggggctccttggggctttggatccctacaagcacaaa
gtgaacatcggcatgatcgaccagtcccgggacgcttccgctgtcagcctgtcagagtcc
aagtcaagtcaggattcctctgactacagcaccagtgaaatgctggtcaacatgggaaac
ctgcccctggacgagttctaccccgctgtgtccatggtggccttgatgcggatcttccga
gatcaatccctctctcaccaccacaccatggtggtgcaggccatcaccttcatcttcaag
tccctggggctcaagtgtgtgcagttcctgccccaggtcatgcccacattccttaatgtc
atccgagtctgtgatggggccatccgggaatttctgttccagcagctggggatgctggtg
tcctttgtgaagagccacatccgtccctacatggatgaaatagtcactctcatgagagag
ttttgggtcatgaacacgtcaatccagagcacaatcattcttctcattgagcagattgtg
gtggctctcggaggggaatttaagctttatctgccccagttgatcccacacatgctgcgg
gtcttcatgcatgacaacagccaaggccgaatcgtctccatcaagctgttagccgcgatc
cagctgtttggcgccaacctggatgactatctgcacttgttgttgcctccgattgtgaaa
ttgtttgatgcccctgaagtcccgctgccatcaagaaaggcagcgctggagacggtggac
cgcctgacagagtccctagacttcactgactacgcctcccgcatcattcacccaatagtt
cgtacgctagaccagagcccagagctgcgctccacagccatggacactctgtcttcgctt
gtctttcaactggggaagaagtaccagatcttcattccaatggtgaataaagtcctcgtg
cgacaccggatcaaccaccagcgctatgatgtgcttatctgcagaatcgtcaaggggtac
acacttgctgatgaggaagaagaccctttgatttaccagcatcgaatgctaaggagcagc
cagggagatgccctggccagtggaccagttgagacaggacccatgaagaaactgcatgtc
agcaccatcaacctccaaaaggcctggggagctgccagaagggtctccaaggacgactgg
ctggagtggctgaggcgcttgagtctggagcttctgaaggactcctcatcgccctccctg
cgctcatgctgggccctggcgcaggcctacaaccccatggccagggatctcttcaatgct
gcctttgtgtcctgctggtctgagctgaatgaagaccagcaagatgagctcatcaggagt
attgagttggctctcacttctcaagacattgctgaagtcacacaaaccctcctgaacttg
gctgagttcatggaacacagtgacaagggccccctgccgctgagagatgacaatggcatc
gtgctcctgggtgagagagctgccaagtgccgggcatatgccaaagcactgcactacaaa
gaactggagttccagaaagggcccacgcctgccatacttgagtccctcatcagcattaac
aacaagctccagcagcctgaggcagcttctggggtgttggaatacgccatgaaacacttc
ggagagctggagatccaggccacctggtatgagaagctgcatgagtgggaggatgctctc
gtggcctacgacaagaagatggacacaaacaaggaagacccggagctgatgctgggccga
atgcgctgcctcgaggccttgggggaatggggccagcttcatcagcagtgctgtgaaaag
tggactctggttaatgatgagacccaggctaagatggcccggatggctgctgctgcagcg
tggggtttaggtcagtgggacagcatggaggagtacacctgcatgatcccacgggacacc
cacgatggagccttttacagggcagtgttggctctacatcaggatctcttctccttggcc
cagcagtgcattgacaaggccagggacctgctggatgcagagctgactgccatggcagga
gagagctacagccgagcctatggggccatggtttcttgccacatgctgtccgagctggaa
gaggttatccagtacaaacttgtccctgagcgtcgggagatcatccggcagatctggtgg
gagagactgcagggctgccagcgtattgttgaggactggcagaaaatcctcatggtccgg
tcccttgtggtcagccctcatgaggacatgagaacctggctcaagtacgcaagcctgtgt
ggcaagagtggcagactggctcttgctcataaaaccttagtgttgctcttgggagttgat
ccatctcggcaacttgaccatcctctgccaaccgctcaccctcaagtgacctatgcctac
atgaagaacatgtggaaaagtgctcggaagattgacgccttccagcacatgcaacacttt
gtgcagaccatgcagcagcaggcccagcatgccatcgccacagaggaccagcagcacaag
caggagctgcataagctcatggccaggtgttttctgaaacttggggagtggcagctgaac
ctccagggcatcaacgagagcaccatccccaaggtgctacagtactacagtgccgccaca
gagcatgaccgcagctggtacaaggcttggcatgcatgggcagtgatgaacttcgaagca
gtgctacactacaaacatcagaaccaagcccgtgatgagaagaagaagctgcgtcatgcc
agcggggccaacatcaccaatgccaccactgcagccaccactgcagcctctgctgctgct
gccaccagcacagagggcagcaacagtgagagtgaagctgagagcaatgagaacagcccc
accccgtcccctctgcagaagaaggtcactgaggatttatccaaaactctcttgttgtac
actgtccctgctgttcaaggcttcttccgttctatctccttgtcaagaggcaacaacctc
caggatacactaagagtcctcaccctgtggtttgattatggtcactggccagatgtcaat
gaagccttggtggaaggggtgaaggccatacagattgacacttggttacaggttatacct
cagctcattgcaagaattgacacacccagacccttggtgggccggctcattcaccagctt
ctcacagatattggtcggtaccacccacaggccctcatctaccccctgacggtggcttct
aagtctaccaccacagcccgtcacaatgcagccaacaagatcttgaagaacatgtgtgaa
cacagcaacacgctggtccagcaggccatgatggtgagtgaagagctgattcgggtagcc
atcctctggcatgagatgtggcatgaaggcctggaagaggcatctcgcttgtactttggg
gagaggaacgtgaaaggcatgtttgaggtgctggagcccctgcatgctatgatggaacgg
ggtccccagactctgaaggaaacatcctttaatcaggcatatggccgagatttaatggag
gcacaagaatggtgtcgaaagtacatgaagtcggggaacgtcaaggacctcacgcaagcc
tgggacctctactatcacgtgttcagacggatctcaaagcagctaccccagctcacatcc
ctggagctgcagtatgtgtcccccaaacttctgatgtgccgagaccttgagttggctgtg
ccaggaacatacgaccccaaccagccaatcattcgcattcaatccatagccccgtctttg
caagtcatcacatccaagcagaggcctcggaagctgactctgatgggcagcaatgggcat
gagtttgttttcctcctgaaaggccatgaagatctgcggcaggatgaacgagtgatgcag
ctctttggcctggtgaacacactcctagccaatgaccccacttctcttcgcaagaacctc
agcatccagagatacgctgtcatccctctgtccaccaactcgggcctcattggctgggtg
ccccactgtgacacactgcatgccctcatccgggactacagagagaagaagaagatcctg
ttgaacatcgagcatcgcatcatgctgcggatggctcctgactatgaccacctgacgttg
atgcagaaggtagaggtgtttgagcatgctgtcaacaacacagctggggacgacctggcc
aagctactgtggctaaaaagccccagctcggaggtgtggtttgaccgaagaaccaactat
acccgctccctggccgttatgtcgatggtcggatacattttaggccttggagacaggcac
ccatccaatctgatgctggaccggctgagtgggaagatcctgcacattgactttggggac
tgctttgaggtcgctatgaccagagagaaatttccagaaaagattccatttagactaaca
agaatgttgaccaatgctatggaggttacgggtctggatggcaactacagaaccacatgc
cacaccgtgatggaagtgctccgggaacacaaggacagtgtcatggctgtgctggaagcc
tttgtctatgacccactgctcaactggaggctgatggacacaaataccaaaggcaataag
cggtcccggacaaggacagactcctactctgccggccagtcagtagaaattttggacggt
gtagaacttggagaaccagcccataagaaagcagggaccactgtgccagaatccatccat
tcattcattggagacggtttggtgaaaccagaagccttaaacaagaaagctattcagatt
attaacagggttcgagataagctcactggtcgggatttctctcatgatgacactttggat
gttccaacccaagtggagctgcttatcaagcaggcaacatctcacgagaacctctgccag
tgctacattggctggtgtcccttctggtaa

DBGET integrated database retrieval system