KEGG   Mus musculus (mouse): 56717Help
Entry
56717             CDS       T01002                                 

Gene name
Mtor, 2610315D21Rik, AI327068, FRAP, FRAP2, Frap1, RAFT1, RAPT1, flat
Definition
(RefSeq) mechanistic target of rapamycin kinase
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu01522  Endocrine resistance
mmu04012  ErbB signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04136  Autophagy - other
mmu04140  Autophagy - animal
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04218  Cellular senescence
mmu04371  Apelin signaling pathway
mmu04630  Jak-STAT signaling pathway
mmu04659  Th17 cell differentiation
mmu04714  Thermogenesis
mmu04910  Insulin signaling pathway
mmu04919  Thyroid hormone signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04930  Type II diabetes mellitus
mmu04931  Insulin resistance
mmu05165  Human papillomavirus infection
mmu05167  Kaposi's sarcoma-associated herpesvirus infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05210  Colorectal cancer
mmu05212  Pancreatic cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05221  Acute myeloid leukemia
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
mmu05230  Central carbon metabolism in cancer
mmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    56717 (Mtor)
   04371 Apelin signaling pathway
    56717 (Mtor)
   04630 Jak-STAT signaling pathway
    56717 (Mtor)
   04066 HIF-1 signaling pathway
    56717 (Mtor)
   04072 Phospholipase D signaling pathway
    56717 (Mtor)
   04151 PI3K-Akt signaling pathway
    56717 (Mtor)
   04152 AMPK signaling pathway
    56717 (Mtor)
   04150 mTOR signaling pathway
    56717 (Mtor)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    56717 (Mtor)
   04136 Autophagy - other eukaryotes
    56717 (Mtor)
  Cell growth and death
   04218 Cellular senescence
    56717 (Mtor)
 Organismal Systems
  Immune system
   04659 Th17 cell differentiation
    56717 (Mtor)
  Endocrine system
   04910 Insulin signaling pathway
    56717 (Mtor)
   04920 Adipocytokine signaling pathway
    56717 (Mtor)
   04919 Thyroid hormone signaling pathway
    56717 (Mtor)
  Aging
   04211 Longevity regulating pathway - mammal
    56717 (Mtor)
   04213 Longevity regulating pathway - multiple species
    56717 (Mtor)
  Environmental adaptation
   04714 Thermogenesis
    56717 (Mtor)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    56717 (Mtor)
   05230 Central carbon metabolism in cancer
    56717 (Mtor)
   05231 Choline metabolism in cancer
    56717 (Mtor)
   05206 MicroRNAs in cancer
    56717 (Mtor)
   05205 Proteoglycans in cancer
    56717 (Mtor)
   05210 Colorectal cancer
    56717 (Mtor)
   05212 Pancreatic cancer
    56717 (Mtor)
   05225 Hepatocellular carcinoma
    56717 (Mtor)
   05226 Gastric cancer
    56717 (Mtor)
   05214 Glioma
    56717 (Mtor)
   05221 Acute myeloid leukemia
    56717 (Mtor)
   05215 Prostate cancer
    56717 (Mtor)
   05224 Breast cancer
    56717 (Mtor)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    56717 (Mtor)
   04931 Insulin resistance
    56717 (Mtor)
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    56717 (Mtor)
   05165 Human papillomavirus infection
    56717 (Mtor)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    56717 (Mtor)
   01522 Endocrine resistance
    56717 (Mtor)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     56717 (Mtor)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   56717 (Mtor)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    56717 (Mtor)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 UME V-ATPase_H_N EPSP_synthase HEAT_EZ
Motif
Other DBs
NCBI-GeneID: 56717
NCBI-ProteinID: NP_064393
MGI: 1928394
Ensembl: ENSMUSG00000028991
Vega: OTTMUSG00000010950
UniProt: Q9JLN9
Position
4 E2; 4 78.76 cM
AA seq 2549 aa AA seqDB search
MLGTGPAVATASAATSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEES
TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNSTRIGRFANYLRNLLPSSDP
VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP
TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEE
AEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC
KDLMGFGTKPRHITPFTSFQAVQPQQPNALVGLLGYSSPQGLMGFGTSPSPAKSTLVESR
CCRDLMEEKFDQVCQWVLKCRSSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV
LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKTVQVDA
TVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL
KMLSLVLMHKPLRHPGMPKGLAHQLASPGLTTLPEASDVASITLALRTLGSFEFEGHSLT
QFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSIHLISGHAHVVSQTAVQVVADVLSKLL
VVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSS
MNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALI
LKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVA
LWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHK
VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFR
DQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLV
SFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLR
VFMHDNSQGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEVPLPSRKAALETVD
RLTESLDFTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLV
RHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSSQGDALASGPVETGPMKKLHV
STINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNA
AFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGI
VLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAASGVLEYAMKHF
GELEIQATWYEKLHEWEDALVAYDKKMDTNKEDPELMLGRMRCLEALGEWGQLHQQCCEK
WTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLA
QQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
ERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVD
PSRQLDHPLPTAHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHK
QELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEA
VLHYKHQNQARDEKKKLRHASGANITNATTAATTAASAAAATSTEGSNSESEAESNENSP
TPSPLQKKVTEDLSKTLLLYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDVN
EALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVAS
KSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYFG
ERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQA
WDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSL
QVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNL
SIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLTL
MQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRH
PSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRTTC
HTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDG
VELGEPAHKKAGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDDTLD
VPTQVELLIKQATSHENLCQCYIGWCPFW
NT seq 7650 nt NT seq  +upstreamnt  +downstreamnt
atgcttgggacgggtcctgccgtggccaccgccagtgccgccacatctagcaacgtgagc
gtcctgcagcagttcgccagtggactgaagagccggaatgaggagaccagggccaaagca
gccaaggagctccagcactacgtcaccatggagcttcgagagatgagtcaggaggagtct
actcgcttctatgaccagctgaaccatcacatttttgaactggtttccagctcagatgcc
aatgagaggaagggtggcatcttggccatcgccagcctcataggagtggaaggtgggaat
tccaccagaattggcagatttgccaactaccttcgaaacctcctcccctcaagcgatcca
gttgtcatggaaatggcgtccaaggccattggccgcctggcgatggcaggggacactttc
actgctgaatatgtggagtttgaagtgaagcgagccttggagtggctgggtgctgaccga
aatgagggccggagacatgccgctgtcctcgttctccgtgagctggccatcagtgtcccc
accttcttcttccagcaagttcagcccttctttgacaacatttttgtggctgtgtgggac
cccaagcaggccatccgggaaggcgctgtagcggcccttcgtgcctgtctgattctcacc
acgcagcgggaaccaaaggaaatgcagaagcctcagtggtaccggcacacatttgaagaa
gcagagaaaggttttgatgagaccctggccaaagagaagggtatgaatcgagatgatcga
atccacggagccttgctgatcctcaacgagctagttcgtatcagcagcatggagggagag
cgtctgagagaagagatggaggagatcacccagcagcagctggtgcatgacaagtactgc
aaagacctcatgggcttcgggaccaagcctcggcacatcacgcccttcaccagtttccag
gctgtgcagccccagcagccgaacgccttggtgggactgctggggtacagctcccctcaa
ggcctgatgggatttgggacgtcccccagccctgccaagtccactctggtggaaagccgc
tgttgcagagacttgatggaagagaaatttgatcaggtgtgccagtgggtgctgaagtgc
aggagcagcaagaactcgctgatccagatgacaatccttaacctgctgccccgcctggct
gcattccgaccgtccgccttcacagatacccagtacctccaggacaccatgaaccatgtc
ctgagctgtgtcaagaaggagaaggaacggactgcggcgttccaggccctggggctgctt
tctgtggccgtgaggtcggagtttaaggtctacttgccccgtgtacttgacatcatccga
gcagcgcttcctccaaaggactttgcccacaagaggcagaaaaccgtgcaggtggatgcc
accgtattcacgtgcatcagcatgttggcacgagcaatggggccgggcatccagcaggac
atcaaggagctgctggagcccatgttggcagtgggcctgagccccgcgctcactgctgtg
ctctatgacctgagccggcagattccacagctgaagaaagatattcaggacggccttctg
aagatgctgtccctggtccttatgcacaaacccctccggcacccaggcatgcccaaaggc
ctggctcaccagctggcttcccctggtctcaccaccctccctgaggccagcgacgtggcc
agcatcactcttgcccttcgaacccttggcagctttgaatttgaaggccactctctgacc
cagttcgtccgacactgcgcagatcacttcctgaacagcgagcacaaggagatccgcatg
gaagctgctcgcacctgctcccgcctgctcacaccctccatccacctcatcagcggccat
gcccacgtggttagccagactgcagtgcaggtggtggcagatgtgctcagcaagctgctt
gtggttggcataacagatcctgaccctgatatccgctactgtgtcttggcatccctggac
gagcgctttgatgcccacctggcccaggcagaaaacttacaagctctgtttgtggctctg
aatgaccaggtctttgagatccgcgagctggccatctgcactgtgggccgactaagcagc
atgaacccagccttcgtcatgcctttcctgcgcaagatgctcatccagatcctgacagag
ctggagcacagcggcattgggagaatcaaggagcagagcgcccgcatgctggggcacctg
gtgtccaacgccccccggctcatccgcccctacatggagcctatcctgaaggctttaatt
ttgaaactgaaagatccagaccctgacccaaacccgggcgtgatcaataacgtgttggcc
actataggagaactggctcaggtgagcggcctggaaatgcggaagtgggtggacgagctc
tttatcatcatcatggacatgctgcaggactcctccctgctggccaaaaggcaggtggct
ttgtggaccctgggacagttggtggccagcactggctatgtggtggagccctacaggaag
taccccactttgcttgaagtgctgctgaatttcctgaagacggagcagaaccagggcact
cggagagaggctatccgagtgttggggctccttggggctttggatccctacaagcacaaa
gtgaacatcggcatgatcgaccagtcccgggacgcttccgctgtcagcctgtcagagtcc
aagtcaagtcaggattcctctgactacagcaccagtgaaatgctggtcaacatgggaaac
ctgcccctggacgagttctaccccgctgtgtccatggtggccttgatgcggatcttccga
gatcaatccctctctcaccaccacaccatggtggtgcaggccatcaccttcatcttcaag
tccctggggctcaagtgtgtgcagttcctgccccaggtcatgcccacattccttaatgtc
atccgagtctgtgatggggccatccgggaatttctgttccagcagctggggatgctggtg
tcctttgtgaagagccacatccgtccctacatggatgaaatagtcactctcatgagagag
ttttgggtcatgaacacgtcaatccagagcacaatcattcttctcattgagcagattgtg
gtggctctcggaggggaatttaagctttatctgccccagttgatcccacacatgctgcgg
gtcttcatgcatgacaacagccaaggccgaatcgtctccatcaagctgttagccgcgatc
cagctgtttggcgccaacctggatgactatctgcacttgttgttgcctccgattgtgaaa
ttgtttgatgcccctgaagtcccgctgccatcaagaaaggcagcgctggagacggtggac
cgcctgacagagtccctagacttcactgactacgcctcccgcatcattcacccaatagtt
cgtacgctagaccagagcccagagctgcgctccacagccatggacactctgtcttcgctt
gtctttcaactggggaagaagtaccagatcttcattccaatggtgaataaagtcctcgtg
cgacaccggatcaaccaccagcgctatgatgtgcttatctgcagaatcgtcaaggggtac
acacttgctgatgaggaagaagaccctttgatttaccagcatcgaatgctaaggagcagc
cagggagatgccctggccagtggaccagttgagacaggacccatgaagaaactgcatgtc
agcaccatcaacctccaaaaggcctggggagctgccagaagggtctccaaggacgactgg
ctggagtggctgaggcgcttgagtctggagcttctgaaggactcctcatcgccctccctg
cgctcatgctgggccctggcgcaggcctacaaccccatggccagggatctcttcaatgct
gcctttgtgtcctgctggtctgagctgaatgaagaccagcaagatgagctcatcaggagt
attgagttggctctcacttctcaagacattgctgaagtcacacaaaccctcctgaacttg
gctgagttcatggaacacagtgacaagggccccctgccgctgagagatgacaatggcatc
gtgctcctgggtgagagagctgccaagtgccgggcatatgccaaagcactgcactacaaa
gaactggagttccagaaagggcccacgcctgccatacttgagtccctcatcagcattaac
aacaagctccagcagcctgaggcagcttctggggtgttggaatacgccatgaaacacttc
ggagagctggagatccaggccacctggtatgagaagctgcatgagtgggaggatgctctc
gtggcctacgacaagaagatggacacaaacaaggaagacccggagctgatgctgggccga
atgcgctgcctcgaggccttgggggaatggggccagcttcatcagcagtgctgtgaaaag
tggactctggttaatgatgagacccaggctaagatggcccggatggctgctgctgcagcg
tggggtttaggtcagtgggacagcatggaggagtacacctgcatgatcccacgggacacc
cacgatggagccttttacagggcagtgttggctctacatcaggatctcttctccttggcc
cagcagtgcattgacaaggccagggacctgctggatgcagagctgactgccatggcagga
gagagctacagccgagcctatggggccatggtttcttgccacatgctgtccgagctggaa
gaggttatccagtacaaacttgtccctgagcgtcgggagatcatccggcagatctggtgg
gagagactgcagggctgccagcgtattgttgaggactggcagaaaatcctcatggtccgg
tcccttgtggtcagccctcatgaggacatgagaacctggctcaagtacgcaagcctgtgt
ggcaagagtggcagactggctcttgctcataaaaccttagtgttgctcttgggagttgat
ccatctcggcaacttgaccatcctctgccaaccgctcaccctcaagtgacctatgcctac
atgaagaacatgtggaaaagtgctcggaagattgacgccttccagcacatgcaacacttt
gtgcagaccatgcagcagcaggcccagcatgccatcgccacagaggaccagcagcacaag
caggagctgcataagctcatggccaggtgttttctgaaacttggggagtggcagctgaac
ctccagggcatcaacgagagcaccatccccaaggtgctacagtactacagtgccgccaca
gagcatgaccgcagctggtacaaggcttggcatgcatgggcagtgatgaacttcgaagca
gtgctacactacaaacatcagaaccaagcccgtgatgagaagaagaagctgcgtcatgcc
agcggggccaacatcaccaatgccaccactgcagccaccactgcagcctctgctgctgct
gccaccagcacagagggcagcaacagtgagagtgaagctgagagcaatgagaacagcccc
accccgtcccctctgcagaagaaggtcactgaggatttatccaaaactctcttgttgtac
actgtccctgctgttcaaggcttcttccgttctatctccttgtcaagaggcaacaacctc
caggatacactaagagtcctcaccctgtggtttgattatggtcactggccagatgtcaat
gaagccttggtggaaggggtgaaggccatacagattgacacttggttacaggttatacct
cagctcattgcaagaattgacacacccagacccttggtgggccggctcattcaccagctt
ctcacagatattggtcggtaccacccacaggccctcatctaccccctgacggtggcttct
aagtctaccaccacagcccgtcacaatgcagccaacaagatcttgaagaacatgtgtgaa
cacagcaacacgctggtccagcaggccatgatggtgagtgaagagctgattcgggtagcc
atcctctggcatgagatgtggcatgaaggcctggaagaggcatctcgcttgtactttggg
gagaggaacgtgaaaggcatgtttgaggtgctggagcccctgcatgctatgatggaacgg
ggtccccagactctgaaggaaacatcctttaatcaggcatatggccgagatttaatggag
gcacaagaatggtgtcgaaagtacatgaagtcggggaacgtcaaggacctcacgcaagcc
tgggacctctactatcacgtgttcagacggatctcaaagcagctaccccagctcacatcc
ctggagctgcagtatgtgtcccccaaacttctgatgtgccgagaccttgagttggctgtg
ccaggaacatacgaccccaaccagccaatcattcgcattcaatccatagccccgtctttg
caagtcatcacatccaagcagaggcctcggaagctgactctgatgggcagcaatgggcat
gagtttgttttcctcctgaaaggccatgaagatctgcggcaggatgaacgagtgatgcag
ctctttggcctggtgaacacactcctagccaatgaccccacttctcttcgcaagaacctc
agcatccagagatacgctgtcatccctctgtccaccaactcgggcctcattggctgggtg
ccccactgtgacacactgcatgccctcatccgggactacagagagaagaagaagatcctg
ttgaacatcgagcatcgcatcatgctgcggatggctcctgactatgaccacctgacgttg
atgcagaaggtagaggtgtttgagcatgctgtcaacaacacagctggggacgacctggcc
aagctactgtggctaaaaagccccagctcggaggtgtggtttgaccgaagaaccaactat
acccgctccctggccgttatgtcgatggtcggatacattttaggccttggagacaggcac
ccatccaatctgatgctggaccggctgagtgggaagatcctgcacattgactttggggac
tgctttgaggtcgctatgaccagagagaaatttccagaaaagattccatttagactaaca
agaatgttgaccaatgctatggaggttacgggtctggatggcaactacagaaccacatgc
cacaccgtgatggaagtgctccgggaacacaaggacagtgtcatggctgtgctggaagcc
tttgtctatgacccactgctcaactggaggctgatggacacaaataccaaaggcaataag
cggtcccggacaaggacagactcctactctgccggccagtcagtagaaattttggacggt
gtagaacttggagaaccagcccataagaaagcagggaccactgtgccagaatccatccat
tcattcattggagacggtttggtgaaaccagaagccttaaacaagaaagctattcagatt
attaacagggttcgagataagctcactggtcgggatttctctcatgatgacactttggat
gttccaacccaagtggagctgcttatcaagcaggcaacatctcacgagaacctctgccag
tgctacattggctggtgtcccttctggtaa

DBGET integrated database retrieval system