KEGG   Mus musculus (mouse): 57014Help
Entry
57014             CDS       T01002                                 

Gene name
Htr3b, 5-HT3B
Definition
(RefSeq) 5-hydroxytryptamine (serotonin) receptor 3B
  KO
K04819  5-hydroxytryptamine receptor 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04726  Serotonergic synapse
mmu04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    57014 (Htr3b)
  Sensory system
   04742 Taste transduction
    57014 (Htr3b)
Ion channels [BR:mmu04040]
 Cys-loop superfamily
  Serotonin (5-HT3)
   57014 (Htr3b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Motif
Other DBs
NCBI-GeneID: 57014
NCBI-ProteinID: NP_064670
MGI: 1861899
Ensembl: ENSMUSG00000008590
Vega: OTTMUSG00000063012
UniProt: Q9JHJ5
Position
9; 9 A5.3
AA seq 437 aa AA seqDB search
MILLWSCLLVAVVGILGTATPQPGNSSLHRLTRQLLQQYHKEVRPVYNWAEATTVYLDLC
VHAVLDVDVQNQKLKTSVWYREVWNDEFLSWNSSLFDEIQEISLPLSALWAPDIIINEFV
DVERSPDLPYVYVNSSGTIRNHKPIQVVSACSLQTYAFPFDIQNCSLTFNSILHTVEDID
LGFLRNREDIENDKRAFMNDSEWQLLSVSSTYHIRQSSAGDFAQIRFNVVIRRCPLAYVV
SLLIPSIFLMLVDLGSFYLPPNCRARIVFKTNVLVGYTVFRVNMSDEVPRSAGCTPLIGV
FFTVCMALLVLSLSKSILLIKFLYEERHSGQERPLMCLQGDSDAEESRLYLGAPRADVTE
SPVHQEHRVPSDTLKDFWFQFRSINNSLRTRDQIHQKEVEWLAILYRFDQLLFRIYLAVL
GLYTVTLCSLWALWSRM
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgattcttctgtggtcctgcctcctggtggctgtagtaggtatcctaggtacagcgaca
cctcagcctgggaattcttctctgcaccgtctcaccaggcagctcttacaacagtaccac
aaggaggtcagaccagtttacaactgggctgaggccaccactgtctacctggacctttgc
gtccatgctgtattggatgtggatgtgcagaatcaaaaattaaagacaagcgtgtggtac
cgagaggtttggaacgatgagtttttgtcctggaactctagtctgttcgatgagattcaa
gagatctctctccctctcagtgccctctgggcccctgatatcatcattaatgagtttgtg
gatgttgaaagatctcctgacctgccctatgtatacgtgaactcttctggcaccattaga
aaccacaagcccatccaggtggtctccgcatgcagtttgcagacatatgctttccccttt
gatatccagaactgcagcctcacctttaatagcattctgcacacagtggaagacatagac
ctgggcttcctgaggaatagagaagacatcgagaatgacaaaagggcttttatgaatgac
agtgagtggcagcttctttctgtgtcctctacttaccacatccggcagagcagcgctgga
gacttcgcacagattcggttcaacgtagtgatccgcagatgtccattggcctacgttgtg
agcctcttgatacctagcatcttcctgatgctcgtggacctgggaagcttctacttgccc
cccaactgccgtgcaagaattgtgttcaagaccaatgtgctggtgggctatacggtcttc
agggtcaacatgtctgatgaagtgccaagaagtgcagggtgcacacctctgattggggtc
ttctttaccgtctgcatggccctcttggttctcagtttatccaaatccatcttgctgatc
aaattcctctatgaggagcggcacagtgggcaagaacggcctcttatgtgccttcaaggc
gactctgatgccgaggagtctagattgtacctcggggctccacgtgctgacgtcacagag
tccccggtccatcaggagcatcgggtcccatcagatactctgaaggatttctggttccag
ttccggtccatcaacaactctcttcgaactcgggatcagattcaccagaaggaggtggag
tggctggccatcctgtatcgctttgatcagctgctcttccgaatctaccttgccgtgctg
gggctctataccgtcaccttatgctctctctgggcactgtggagcagaatgtga

DBGET integrated database retrieval system