KEGG   Mus musculus (mouse): 57357Help
Entry
57357             CDS       T01002                                 

Gene name
Srd5a3, 1110025P14Rik, A430076C09, AV364670, AW987574, D730040M03Rik, H5ar, S5AR_3, Srd5a2l
Definition
steroid 5 alpha-reductase 3 (EC:1.3.1.22 1.3.1.94)
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
mmu  Mus musculus (mouse)
Pathway
Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    57357 (Srd5a3)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     57357 (Srd5a3)
    1.3.1.94  polyprenol reductase
     57357 (Srd5a3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5 C3.3; 5
AA seq 330 aa AA seqDB search
MAGWAGFELSALNPLRTLWLALAAAFLFALLLQLAPARLLPSCALFQDLLRYGKTKQSGS
RRPAVCRAFDVPKRYFSHFYVISVVWNGSLLWLLSQSLFLGAPFPNWLSALLRTLGATQF
QALEMESKASRMPAAELALSAFLVLVFLWVHSLRRLFECFYVSVFSNAAIHVVQYCFGLV
YYVLVGLTVLSQVPMDDKNVYVLGKNLLIQARWFHILGMVMFFWSSAHQYKCHVILSNLR
RNKKGVVIHCQHRIPFGDWFEYVSSANYLAELMIYISMAVTFGLHNLTWWLVVTYVFSSQ
ALSAFFNHKFYRSTFVSYPKHRKAFLPFLF
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggctgggtgggccgggtttgagctctcggccctgaaccccctgcggacgctgtggctg
gcgctggccgccgccttcctgttcgcgctgctgctgcagctggcgcccgccaggctgctg
ccgagctgcgcgctcttccaggacctgctccgctacgggaagaccaagcagtccggctcg
cggcgccccgccgtctgcagggccttcgatgtccccaagaggtacttttctcacttctac
gtcatctcagttgtgtggaatggctccctgctctggctactttctcagtcgttgttcctg
ggagcaccttttccaaactggcttagtgctctgctcagaactcttggggccacacagttc
caagccctggagatggagtccaaggcttctcggatgccagcggctgagctggctctgtct
gccttcttggtcttggtgttcctctgggtccacagccttcggagactctttgagtgcttc
tacgtcagtgtcttctctaatgcagccattcacgttgtgcagtactgtttcgggcttgtc
tactatgtgcttgttggcctgactgtactgagccaagtgcccatggatgataagaatgtg
tatgttctggggaagaatctactgatacaagcccggtggttccacatcctgggcatggtg
atgttcttctggtcatccgcccatcagtataaatgccacgtcatcctcagcaacctcagg
agaaacaaaaaaggtgtggtcatccactgccagcaccggatcccctttggagactggttc
gagtacgtgtcttcagctaactacctagcagagctgatgatctacatctccatggctgtc
acctttgggctccacaacttaacctggtggctggtggtgacgtatgtcttctccagccaa
gccttgtccgcattcttcaaccacaagttctacagaagcacatttgtctcctacccaaag
cataggaaagcgttcctcccatttttgttttaa

DBGET integrated database retrieval system