KEGG   Mus musculus (mouse): 57385Help
Entry
57385             CDS       T01002                                 

Gene name
P2ry4, P2Y4, P2Y4R
Definition
(RefSeq) pyrimidinergic receptor P2Y, G-protein coupled, 4
  KO
K04271  
purinergic receptor P2Y, G protein-coupled, 4
Organism
mmu  Mus musculus (mouse)
Pathway
Neuroactive ligand-receptor interaction
Taste transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    57385 (P2ry4)
 Organismal Systems
  Sensory system
   04742 Taste transduction
    57385 (P2ry4)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Base and nucleoside
   Purine / pyrimidine
    57385 (P2ry4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
X; X C2
AA seq 361 aa AA seqDB search
MTSADSLLFTSLGPSPSSGDGDCKFNEEFKFILLPLSYAVVFVLGLALNAPTLWLFLFRL
RPWDATATYMFHLALSDTLYVLSLPTLVYYYAARNHWPFGTGFCKFVRFLFYWNLYCSVL
FLTCISVHRYMGICHPLRAIRWGRPRFAGLLCLGVWLVVAGCLVPNLFFVTTNANGTTIL
CHDTTLPEEFDHYVYFSSTIMVLLFGFPFLITLVCYGLMARRLYRPLPGAGQSSSRLRSL
RTIAVVLTVFAVCFVPFHITRTIYYLARLLNAECRVLNIVNVVYKVTRPLASANSCLDPV
LYLFTGDKYRNQLQQLCRGSTPKRRTTASSLALVTLHEESISRWADIHQDSIFPAYEGDR
L
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaccagtgcagactccttgctattcacatcactaggtcccagcccaagttctggagat
ggtgattgtaagtttaatgaggaattcaagttcatcctgttgcctctgagctatgcagtt
gtctttgtgctgggcctggccctcaatgccccaaccctttggctgttcctcttccgcctt
cgaccctgggatgcaacagccacttacatgttccatttggcattgtcagacaccttgtat
gtgctgtcactgcccaccctcgtctactactatgctgccagaaaccactggccctttggc
actggcttctgcaagttcgtccgctttcttttctactggaacctctactgcagtgtcctt
ttcctcacctgcatcagtgtgcaccgctacatgggcatctgccatccactgcgggcaata
cgctggggccgccctcgatttgcaggtcttctctgcctaggtgtttggttggtagtagct
ggctgcctcgtgcccaacctcttctttgtgacaaccaatgccaatggaaccaccatcctg
tgccatgacacgactctgcctgaggagtttgaccactacgtatacttcagttccacaatc
atggtgctgctctttggctttcccttcttgatcactctggtctgctatggactcatggcc
cggcgactgtatcgacctttgccaggagctggacagtcatcttctcggctccgttctctc
cgcaccattgctgtggtgctgactgtctttgctgtctgctttgtgcctttccacatcacc
cgcacaatttattacctggcaagactgttgaacgccgaatgccgggtgctgaacattgtc
aatgtggtttacaaagtgactcgtcccctggccagtgctaatagctgtcttgatccagtg
ctctatctgttcacgggggacaagtatcgaaaccagctccagcagctatgcagaggtagc
acacctaagcgccgaacaactgcttcctccctggcattggtgaccctacatgaagaaagc
atcagcaggtgggcggacatccaccaagacagcatcttccctgcttatgagggtgaccga
ttataa

DBGET integrated database retrieval system