KEGG   Mus musculus (mouse): 57746Help
Entry
57746             CDS       T01002                                 

Gene name
Piwil2, Piwil1l, mili
Definition
(RefSeq) piwi-like RNA-mediated gene silencing 2
  KO
K02156  
aubergine
Organism
mmu  Mus musculus (mouse)
Pathway
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    57746 (Piwil2)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  RNA silencing
   RISC (RNA-induced silencing complex)
    57746 (Piwil2)
   piRNA pathway
    57746 (Piwil2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
14; 14 D2
AA seq 971 aa AA seqDB search
MDPVRPLFRGPTPVHPSQCVRMPGCWPQAPRPLEPAWGRAGPAGRGLVFRKPEDSSPPLQ
PVQKDSVGLVSMFRGMGLDTAFRPPSKREVPPLGRGVLGRGLSANMVRKDREEPRSSLPD
PSVLAAGDSKLAEASVGWSRMLGRGSSEVSLLPLGRAASSIGRGMDKPPSAFGLTARDPP
RLPQPPALSPTSLHSADPPPVLTMERKEKELLVKQGSKGTPQSLGLNLIKIQCHNEAVYQ
YHVTFSPSVECKSMRFGMLKDHQSVTGNVTAFDGSILYLPVKLQQVVELKSQRKTDDAEI
SIKIQLTKILEPCSDLCIPFYNVVFRRVMKLLDMKLVGRNFYDPTSAMVLQQHRLQIWPG
YAASIRRTDGGLFLLADVSHKVIRNDSVLDVMHAIYQQNKEHFQDECSKLLVGSIVITRY
NNRTYRIDDVDWNKTPKDSFVMSDGKEITFLEYYSKNYGITVKEDDQPLLIHRPSERQNN
HGMLLKGEILLLPELSFMTGIPEKMKKDFRAMKDLTQQINLSPKQHHGALECLLQRISQN
ETASNELTRWGLSLHKDVHKIEGRLLPMERINLRNTSFVTSEDLNWVKEVTRDASILTIP
MHFWALFYPKRAMDQARELVNMLEKIAGPIGMRISPPAWVELKDDRIETYIRTIQSLLGV
EGKIQMVVCIIMGTRDDLYGAIKKLCCVQSPVPSQVINVRTIGQPTRLRSVAQKILLQMN
CKLGGELWGVDIPLKQLMVIGMDVYHDPSRGMRSVVGFVASINLTLTKWYSRVVFQMPHQ
EIVDSLKLCLVGSLKKYYEVNHCLPEKIVVYRDGVSDGQLKTVANYEIPQLQKCFEAFDN
YHPKMVVFVVQKKISTNLYLAAPDHFVTPSPGTVVDHTITSCEWVDFYLLAHHVRQGCGI
PTHYICVLNTANLSPDHMQRLTFKLCHMYWNWPGTIRVPAPCKYAHKLAFLSGQILHHEP
AIQLCGNLFFL
NT seq 2916 nt NT seq  +upstreamnt  +downstreamnt
atggatcctgtcaggccgttgttcagggggcccaccccagtccacccatctcagtgtgtg
cggatgccaggctgttggcctcaagctcctagacctttggaaccagcttggggtagggca
ggacctgcaggcagaggccttgtgtttagaaaaccagaagactccagcccaccactccag
ccagtacaaaaggattctgtaggtttggtgtccatgttccgtggcatgggtcttgacaca
gcattccggcctccttcaaaacgagaagtgcctcctttaggcagaggagttctaggtcga
ggcttgtctgctaacatggtccgcaaggacagagaagaaccccgttcctctttgcctgat
ccttcggtgctggcagctggggacagcaaactggcagaggcttctgttggttggagtaga
atgctgggaagaggtagttctgaggtctctctgttaccactgggacgagcagccagtagt
ataggcagaggaatggacaaacctcccagtgcctttggcctcacagctcgggatccccca
cggctgccacagcctccagctctgtctccaacttcactgcactctgccgatccccctccg
gtcctgactatggaacgaaaggaaaaagagcttttggtcaagcaaggatcaaaaggaact
cctcagtctttgggactgaacctcatcaaaatccagtgtcataacgaagcagtttatcag
taccatgtgactttcagccccagtgtggaatgcaaaagcatgaggtttggcatgttgaag
gaccaccagtctgtcactggaaacgtcactgcttttgatggctctattctttatcttcct
gttaagcttcaacaagttgttgagttaaaaagtcagaggaaaactgacgatgccgagatc
agtatcaagattcagctgacaaagatcctggagccgtgttctgacctgtgcatccccttc
tacaatgttgtcttccggcgggtaatgaaacttctggatatgaagcttgtggggagaaac
ttctatgaccctacaagtgccatggtactgcagcaacacagattgcagatctggcctggc
tatgcggctagtatccggaggacagacgggggtctcttcctgctcgctgatgtctctcat
aaggtcattcggaacgactctgtgctggatgtcatgcatgctatctaccagcagaacaag
gagcacttccaggacgagtgcagcaagcttctggttggcagcattgtcatcacgcgctac
aacaatcgtacctaccgaatcgatgatgtggactggaacaagacccctaaagacagcttt
gtcatgtcggacgggaaggaaatcacattcctggaatactacagcaaaaactatgggatc
acagtcaaggaagatgaccagccgctgctgatccaccggcccagtgagagacagaataac
catggcatgttgctgaagggcgagatcctgctgctgcccgagctctccttcatgacgggg
atccctgagaagatgaagaaggacttcagggccatgaaggacttgactcagcagattaac
ctgagccccaagcagcaccacggtgctttggaatgcctgctgcagagaatttcacaaaac
gagacagccagcaatgagctgacccgctgggggctcagtctgcataaagatgtccacaag
attgaaggtcggcttctgccaatggagaggatcaacttaaggaacacttcatttgtcaca
tcggaggacctgaactgggttaaggaagtgaccagagatgcttccattctaactattccc
atgcatttctgggcactcttttatccaaagagagcaatggaccaagccagagaactggtt
aacatgttggaaaagattgccgggcccattggcatgcgcataagccccccagcctgggtt
gagctgaaggatgaccgaatagagacctatatcaggaccattcagtccttactgggagtt
gaggggaagatacaaatggtcgtttgcatcatcatgggcacacgtgatgatctctatgga
gccatcaagaagctgtgctgcgtgcagtccccagtgccctcacaggtcatcaatgtccga
accattggtcagcccaccaggcttcggagcgtggctcagaaaattttacttcagatgaac
tgtaaactgggtggtgagctctggggagtggatattccgctgaaacaactaatggtgatt
ggaatggatgtgtaccatgaccccagcagaggcatgcgctctgtggtcggcttcgtggcc
agcataaatctcacactcaccaaatggtactcgagggtggtgttccagatgccacatcag
gagattgtggacagcctgaagctctgcctggtgggttccttgaaaaagtattatgaggtg
aaccattgtctcccagagaaaattgtggtgtaccgagatggagtgtctgatggccagcta
aagacagttgccaactacgagatccctcagctgcagaagtgttttgaagcctttgataac
taccaccccaagatggtggtgtttgtagttcagaagaaaatcagcaccaatctgtacctt
gctgctcctgatcacttcgtaaccccctcccccgggactgtggttgatcataccataacc
agctgtgagtgggtggatttctaccttcttgcccatcatgtgcgacagggctgtggcata
cctacacactacatctgtgttctgaacactgcaaatctgagccctgatcacatgcagagg
ttgactttcaaactatgccacatgtactggaattggcctggtaccatccgagttccagct
ccttgcaagtatgcccacaagctagctttcctgtccggacagattttgcatcatgagcca
gccatccagctgtgtgggaacctgttcttcctgtaa

DBGET integrated database retrieval system