KEGG   Mus musculus (mouse): 57775Help
Entry
57775             CDS       T01002                                 

Gene name
Usp29, Ocat
Definition
ubiquitin specific peptidase 29 (EC:3.4.19.12)
Orthology
K11850  
ubiquitin carboxyl-terminal hydrolase 26/29/37 [EC:3.1.2.15]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     57775 (Usp29)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   57775 (Usp29)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
UniProt: 
Position
7 A1; 7 4.04 cM
AA seq 869 aa AA seqDB search
MAHLKINGLVQIRSTNRSKHTRASQWKEAVIEIVERKQKVNLVVSFKLEERRRVFQLGDN
VTGVVVSGELGLYHLDLTLRDDTSLLIDKLSSADVEHLKSFLDSSTPCESQQPMEPMSSQ
DDLESSDPFCGEHQEAACGSLNTTPESGTPLSRKMPLSMSNTTGGQKRGEKQGRKRKTEP
SSSSAEVNKDIPKENTPDQKKKSRRYYSRNRGGKAEKAVTLREQEKRSNWKLEPAFNSKS
YGRANLDGTILPIATCSDDRDVSIFGLEIITHNGVQSLPDPYLNQLKREGFPNLGNTCYM
NSILQSVFGIPTFAKDLLTQGIPWEKVSYDDLIMPLSQLLVLKDIRDVEIKGELLTSVKK
SISTVADTFSGNEQNDAHEFLSLCLDQLKLNMEKVNAMWDTERRNTCAGSAGTKRFVCPV
GANFEFELHSSIICEGCGEATIKTEVSNYLSIDLHHGTKTHPLSIQKSFDLFFTPEKIEH
NCEKCKNKNSVLKYTLRRLPRVLIVHLKRYQVTTDLLPVKSEQPVEISKYLNISSHCHEN
RKLPFPLANTSPDVSQGMMPGIFNQSMLSKKVISESCDPMVLQVGSSVDAEIQSFQIMYE
DEDASEEQQQRGLESGSMLEPELVKTENRILRQKTSLATDSMMGDGYSFLPMLCEPLSIQ
DPGLAEMGLQEVPENPEFKNYEKINIYGKSDGRTNTELSKLYQNHGSRIKGLFLPASLAS
VSSQEDPEKDLSRSPELQEDDPHSFAFGSDDSKDGEMGDDLQNYRLVSVVSHFGSSPNSG
HYVSDVYDFQKQAWLLYSDVQVFESSDPSIQENRLNSGYIFFYMHNEIFEELLKKASECK
VLSTSKEEKRDIDYFSTLLNGLTYILEEF
NT seq 2610 nt NT seq  +upstreamnt  +downstreamnt
atggctcacctaaagataaatggtttggtccagatccgcagcacaaacaggagcaagcac
accagggcatctcagtggaaggaagcagtcatcgaaatagtagaaagaaaacagaaagtt
aatctggtggtttctttcaagttggaagaaaggagaagggtgtttcagctgggtgataat
gttacaggcgtagtggttagtggtgagctgggactgtatcatctggatttaactttgaga
gacgacacatccttactcatcgacaagttatcctctgcagatgttgaacatttgaagtca
ttcctggattcgtctactccatgtgagtcccagcaacccatggagcccatgagtagtcag
gatgaccttgaaagcagtgatccattttgcggggagcaccaggaggcagcctgtggatcc
ctgaataccactccagaaagtgggacaccactgtcccgcaagatgccactttctatgtca
aacaccacgggcggccaaaagagaggagaaaaacaaggcagaaagaggaagacagaacca
tcctcctccagcgcagaagtgaacaaggacattcccaaagaaaatactcctgaccaaaaa
aagaaatccaggcgatattattccaggaacagaggcggcaaagcagagaaagctgtgacc
ttaagagaacaagaaaagcgtagcaattggaaacttgaacctgctttcaattccaaatcc
tatggaagggctaacctggatggcactatccttccaatcgcgacatgctctgatgacaga
gatgtatcaatatttggactggagatcataacacataatggagtccaatctcttcctgac
ccttacctaaatcaactaaaacgtgaaggcttcccaaacttgggaaatacttgttacatg
aattccattttgcaatctgtctttgggattccaacctttgcaaaggacttactcactcaa
ggcatcccatgggagaaagtctcctacgatgaccttatcatgcccttaagccagctcctt
gtcttgaaagacattcgggatgtagagatcaagggggagttactcaccagtgtaaagaag
tccatttccacagttgcagacacattctcgggcaatgaacagaacgatgcccatgagttt
ttaagtctgtgtttagaccagctgaaactgaacatggaaaaagtaaatgccatgtgggat
actgagaggagaaacacatgtgctgggtctgctggcaccaaaaggtttgtttgtcccgtt
ggagctaattttgaatttgagctgcatagctccatcatctgtgaaggctgtggtgaggct
actatcaaaaccgaagtgagtaattacctctccattgacctgcaccatgggacaaaaaca
caccctctatcaattcaaaagtcttttgatcttttctttacaccagaaaaaattgagcat
aactgtgagaaatgtaagaacaagaattctgttctcaagtacacattgaggagactcccc
agggtcctcattgttcatctgaaacgctaccaagttaccactgacttgttgccagtgaag
agtgagcagccagttgagatttctaagtatttaaatatatcttcccactgccatgaaaac
aggaagctaccatttcccttggctaatacatccccagatgtctctcaagggatgatgcct
gggatcttcaaccagtcaatgttatctaagaaggtgatttcagaatcctgtgaccccatg
gttctacaggttggatccagtgtggatgctgaaatacaaagcttccagataatgtatgag
gatgaagatgcaagtgaggagcagcagcagagaggcctggaaagtggctccatgctggag
ccagaactagtgaagacagaaaaccggatactcagacaaaagacatcactagcaactgac
tcaatgatgggtgacggatacagcttccttcctatgctctgtgagcctctgagcatccaa
gatccaggtcttgcagagatgggtcttcaagaggttccagagaatccagaatttaagaac
tatgagaaaattaacatatatggaaagtcagatggccgcactaacactgagttgtcaaaa
ctctaccagaatcatggaagtcgaatcaagggtttgttcctaccggcatcccttgcaagt
gttagttctcaggaagacccagagaaggacctgagtaggtctccagaattgcaggaagat
gacccacattcctttgcatttggttctgatgattccaaagatggggagatgggagatgat
cttcagaattacaggctcgtcagtgtggtcagccactttgggagctccccaaattcaggc
cattacgtaagtgatgtgtatgactttcaaaagcaagcctggctcctttacagtgatgtc
caagtgttcgagagttcagatccctccattcaggagaacaggctaaacagcggatacatc
ttcttttacatgcataatgagatttttgaggaactgttgaaaaaggcatctgagtgcaag
gtccttagcacatctaaggaggaaaagagggacatagattacttctcaacattgcttaac
ggccttacatacatcctggaagaattctaa

DBGET integrated database retrieval system