KEGG   Mus musculus (mouse): 58231Help
Entry
58231             CDS       T01002                                 

Gene name
Stk4, AI447339, AU020804, Kas-2, Mst1, Ysk3
Definition
(RefSeq) serine/threonine kinase 4 (EC:2.7.11.1)
  KO
K04411  
serine/threonine kinase 4
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
Ras signaling pathway
FoxO signaling pathway
Pathways in cancer
Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    58231 (Stk4)
   04010 MAPK signaling pathway
    58231 (Stk4)
   04068 FoxO signaling pathway
    58231 (Stk4)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    58231 (Stk4)
   05223 Non-small cell lung cancer
    58231 (Stk4)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: STE group
  STE20 family
   58231 (Stk4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2; 2 H3
AA seq 487 aa AA seqDB search
METVQLRNPPRRQLKKLDEDSLTKQPEEVFDVLEKLGEGSYGSVYKAIHKETGQIVAIKQ
VPVESDLQEIIKEISIMQQCDSPHVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKT
LTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAK
RNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNP
PPTFRKPELWSDNFMDFVKQCLVKSPEQRATATQLLQHPFVKSAKGVSILRDLINEAMDV
KLKRQEAQQREVDQDDEENSEEDEMDSGTMVRAAGDEMGTVRVASTMSGGANTMIEHGDT
LPSQLGTMVINTEDEEEEGTMKRRDETMQPAKPSFLEYFEQKEKENQINSFGKNVSGSLK
NSSDWKIPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEMEEIRQKYRSKRQPILDAIEAK
KRRQQNF
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggagaccgtgcagctgaggaacccaccgcgcaggcagctgaaaaagttggatgaagat
agtttaaccaagcagcccgaggaagtgtttgatgtcttagagaagcttggagaggggtct
tatggcagcgtgtacaaggctattcataaagagactggccagattgttgcaatcaagcaa
gtgcccgtggaatcggacctgcaggagataatcaaggaaatctccatcatgcagcagtgt
gacagccctcacgtagtcaagtattatggcagctactttaagaacacagacctgtggatt
gttatggagtactgtggggctggttctgtatctgatatcattcggctacggaacaagacg
ttaacagaagatgaaatagctacaatattacaatcaactcttaagggactagaatacctt
cattttatgagaaaaatacaccgagatatcaaggcgggaaatattttgctaaacacagaa
ggccatgcaaagcttgcagactttggagtcgcaggtcaacttacagataccatggcaaag
aggaatacagtaatagggaccccgttttggatggctcctgaagttattcaggaaattggg
tacaactgtgtggcagacatctggtctctgggaataactgccatagaaatggctgaagga
aagcccccatatgctgatatccatccaatgagggcaatattcatgattcctacaaaccct
cctcccacattccgtaagccagagctgtggtcagacaacttcatggattttgtgaagcag
tgtctggtaaaaagcccggagcagagagccacagccactcagctcctacagcacccgttt
gttaagagtgccaaaggagtgtcaatattgcgagacttaattaacgaagccatggatgtg
aaactgaagcgccaggaagcccagcagcgggaagtggaccaggacgacgaggagaactca
gaggaggatgaaatggattccggcacgatggttcgagctgccggtgatgagatgggcact
gtccgagtagccagcacgatgagcggaggagccaatactatgattgagcacggtgacacg
ttgccgtcccagctgggcaccatggtgatcaacacggaggacgaggaagaggaaggaacc
atgaaaagaagagatgagaccatgcagcctgcaaaaccgtctttccttgaatactttgaa
caaaaagaaaaggaaaatcagatcaacagctttggcaagaatgtatctggctctctgaag
aattcttccgattggaaaatccctcaggatggagactatgagtttctcaagagctggact
gtggaggaccttcagaagaggctcttggccctcgaccccatgatggaacaggaaatggaa
gagatccggcagaagtaccggtccaagcggcagccaatcctggatgccattgaagccaag
aagaggaggcaacagaacttctga

DBGET integrated database retrieval system