KEGG   Mus musculus (mouse): 58800Help
Entry
58800             CDS       T01002                                 

Gene name
Trpm7, 2310022G15Rik, 4833414K03Rik, 5033407O22Rik, CHAK, CHAK1, LTrpC-7, Ltpr7, Ltrpc7, TRPPLIK
Definition
(RefSeq) transient receptor potential cation channel, subfamily M, member 7 (EC:2.7.11.1)
  KO
K04982  
transient receptor potential cation channel subfamily M member 7 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Mineral absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Digestive system
   04978 Mineral absorption
    58800 (Trpm7)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     58800 (Trpm7)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: Atypical group
  Alpha family [OT]
   58800 (Trpm7)
Ion channels [BR:mmu04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPM (Melastatin/Long TRP)
   58800 (Trpm7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2; 2 F2
AA seq 1863 aa AA seqDB search
MSQKSWIESTLTKRECVYIIPSSKDPHRCLPGCQICQQLVRCFCGRLVKQHACFTASLAM
KYSDVKLGEHFNQAIEEWSVEKHTEQSPTDAYGVINFQGGSHSYRAKYVRLSYDTKPEII
LQLLLKEWQMELPKLVISVHGGMQKFELHPRIKQLLGKGLIKAAVTTGAWILTGGVNTGV
AKHVGDALKEHASRSSRKICTIGIAPWGVIENRNDLVGRDVVAPYQTLLNPLSKLNVLNN
LHSHFILVDDGTVGKYGAEVRLRRELEKTINQQRIHARIGQGVPVVALIFEGGPNVILTV
LEYLQESPPVPVVVCEGTGRAADLLAYIHKQTEEGGNLPDAAEPDIISTIKKTFNFGQSE
AVHLFQTMMECMKKKELITVFHIGSEDHQDIDVAILTALLKGTNASAFDQLILTLAWDRV
DIAKNHVFVYGQQWLVGSLEQAMLDALVMDRVSFVKLLIENGVSMHKFLTIPRLEELYNT
KQGPTNPMLFHLIRDVKQGNLPPGYKITLIDIGLVIEYLMGGTYRCTYTRKRFRLIYNSL
GGNNRRSGRNTSSSTPQLRKSHETFGNRADKKEKMRHNHFIKTAQPYRPKMDASMEEGKK
KRTKDEIVDIDDPETKRFPYPLNELLIWACLMKRQVMARFLWQHGEESMAKALVACKIYR
SMAYEAKQSDLVDDTSEELKQYSNDFGQLAVELLEQSFRQDETMAMKLLTYELKNWSNST
CLKLAVSSRLRPFVAHTCTQMLLSDMWMGRLNMRKNSWYKVILSILVPPAILMLEYKTKA
EMSHIPQSQDAHQMTMEDSENNFHNITEEIPMEVFKEVKILDSSDGKNEMEIHIKSKKLP
ITRKFYAFYHAPIVKFWFNTLAYLGFLMLYTFVVLVKMEQLPSVQEWIVIAYIFTYAIEK
VREVFMSEAGKISQKIKVWFSDYFNVSDTIAIISFFVGFGLRFGAKWNYINAYDNHVFVA
GRLIYCLNIIFWYVRLLDFLAVNQQAGPYVMMIGKMVANMFYIVVIMALVLLSFGVPRKA
ILYPHEEPSWSLAKDIVFHPYWMIFGEVYAYEIDVCANDSTLPTICGPGTWLTPFLQAVY
LFVQYIIMVNLLIAFFNNVYLQVKAISNIVWKYQRYHFIMAYHEKPVLPPPLIILSHIVS
LFCCVCKRRKKDKTSDGPKLFLTEEDQKKLHDFEEQCVEMYFDEKDDKFNSGSEERIRVT
FERVEQMSIQIKEVGDRVNYIKRSLQSLDSQIGHLQDLSALTVDTLKTLTAQKASEASKV
HNEITRELSISKHLAQNLIDDVPVRPLWKKPSAVNTLSSSLPQGDRESNNPFLCNIFMKD
EKDPQYNLFGQDLPVIPQRKEFNIPEAGSSCGALFPSAVSPPELRQRRHGVEMLKIFNKN
QKLGSSPNSSPHMSSPPTKFSVSTPSQPSCKSHLESTTKDQEPIFYKAAEGDNIEFGAFV
GHRDSMDLQRFKETSNKIRELLSNDTPENTLKHVGAAGYSECCKTSTSLHSVQAESCSRR
ASTEDSPEVDSKAALLPDWLRDRPSNREMPSEGGTLNGLASPFKPVLDTNYYYSAVERNN
LMRLSQSIPFVPVPPRGEPVTVYRLEESSPSILNNSMSSWSQLGLCAKIEFLSKEEMGGG
LRRAVKVLCTWSEHDILKSGHLYIIKSFLPEVINTWSSIYKEDTVLHLCLREIQQQRAAQ
KLTFAFNQMKPKSIPYSPRFLEVFLLYCHSAGQWFAVEECMTGEFRKYNNNNGDEIIPTN
TLEEIMLAFSHWTYEYTRGELLVLDLQGVGENLTDPSVIKAEEKRSCDMVFGPANLGEDA
IKNFRAKHHCNSCCRKLKLPDLKRNDYTPDKIIFPQDESSDLNLQSGNSTKESEATNSVR
LML
NT seq 5592 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagaaatcctggatagagagcactttgaccaagagggagtgtgtatatattata
ccaagctccaaagaccctcacagatgtcttccaggatgtcagatttgtcagcaacttgtc
agatgtttctgtggtcgtttggtcaagcaacatgcatgctttactgcaagtcttgccatg
aaatactcagatgtgaaattgggtgaacactttaaccaggcaatagaagaatggtctgtg
gaaaagcacacggagcagagcccaacagatgcttatggagtcatcaattttcaagggggt
tctcattcctacagagctaagtatgtgagactatcatatgataccaaacctgaaatcatt
ctgcaacttctgcttaaagaatggcaaatggagttacccaaacttgttatttctgtacat
ggaggcatgcagaagtttgaacttcatccaagaatcaagcagttgcttggaaagggtctt
attaaagctgcagttacaaccggagcttggattttaactggaggagtcaatacaggtgtg
gcaaaacatgttggtgatgccctcaaagaacatgcttccagatcatctcgaaaaatttgc
actattggaatagctccatggggagtgatagaaaacagaaatgatcttgttgggagagat
gtggttgctccttatcaaaccctattgaatcccttgagcaaattgaatgttctgaataat
ctacactcccatttcatcttggtggatgatggcactgttggaaagtatggggcagaagtc
agactgagaagagaacttgaaaaaaccattaatcagcaaagaattcatgctagaattggg
caaggagttcctgtggtggctttgatatttgaaggcgggccaaatgtcatccttacagta
ctggagtaccttcaggaaagccccccagttccagttgttgtgtgtgaagggacaggcaga
gctgcagatttactagcctatatccacaaacagacagaggaaggaggaaatcttcctgat
gcagcagagcctgatattatatcaactatcaagaaaacatttaactttggccagagtgaa
gcagttcatttatttcaaacaatgatggagtgtatgaaaaaaaaagagcttatcactgtt
tttcacattggatcagaggatcatcaagatatagatgtggccatactcactgcactgctg
aaaggtactaatgcatctgcatttgaccagcttatccttacactggcatgggacagagtt
gatattgccaaaaatcatgtatttgtttatggacaacagtggctggttggatccttggaa
caggctatgcttgatgctcttgtaatggacagagtttcatttgtaaaacttcttattgaa
aacggagtaagcatgcataaattccttaccattcccagactggaagaactttataacact
aaacaaggtccaaccaatccaatgttgttccatctcattcgggatgtcaagcagggtaat
ctccccccggggtacaagatcactttaattgatataggacttgtgattgagtatctcatg
ggaggaacctacagatgcacatacacacgaaaacgttttcgattgatatataatagtctt
ggtggaaataaccggaggtcaggtcgaaatacctccagcagcacccctcagttgcgaaag
agtcatgaaacttttggcaatagagctgataaaaaggaaaaaatgagacacaatcatttc
attaaaacagcccaaccctacagaccaaagatggatgcatctatggaagaaggaaagaag
aaaagaaccaaagatgaaattgtagatatagatgatccagagaccaagcgctttccttat
cctcttaatgaattattaatttgggcttgccttatgaagaggcaggtcatggcccgcttt
ttatggcagcatggtgaagaatcaatggctaaagcattagttgcctgtaaaatctatcgt
tcaatggcttatgaggcaaagcagagtgacctggtagatgatacttcagaggaactgaag
cagtattccaatgattttggccaactggcagttgaattactggaacagtccttcagacag
gatgaaacgatggctatgaaattactcacttatgaactcaaaaactggagtaattcaacc
tgcctcaagttagcagtttcttcaagacttagaccttttgtagctcacacttgtacacag
atgttgttatctgatatgtggatgggacggctgaatatgagaaaaaattcctggtataag
gtcatattaagcattttagttccacctgccatattaatgctagagtataaaaccaaggct
gaaatgtcccatatcccacaatctcaagatgctcatcaaatgacgatggaggatagtgaa
aacaattttcacaacataacagaagagatacccatggaagtatttaaagaagtaaagatt
ttggacagcagtgatggaaagaatgaaatggagatacatattaaatcaaaaaagcttcca
atcacacgaaaattttatgccttttatcatgcaccaattgtaaagttctggtttaacaca
ttggcatatttaggatttctgatgctttatacatttgtagttcttgtaaaaatggaacag
ttaccttcagttcaagaatggattgttatcgcttatatttttacctatgctattgaaaaa
gtccgtgaggtcttcatgtctgaagctgggaaaatcagccagaagattaaagtatggttt
agtgactacttcaatgtcagtgacacaattgccatcatttctttctttgttggatttgga
ctaagatttggagcaaaatggaactatattaatgcatatgataatcatgtttttgtggct
ggaagattaatttactgtcttaatataatattttggtatgtgcgtttgctagactttcta
gccgtaaatcaacaggcaggaccttatgtaatgatgattggaaaaatggtggccaatatg
ttctacattgtagtgataatggctcttgtattgcttagttttggtgttcccagaaaagca
atactttatccacatgaagaaccatcttggtctcttgctaaagatatagtttttcatcca
tactggatgatttttggtgaagtttatgcatatgaaattgatgtgtgtgcaaatgactcc
actctcccgacaatctgtggtcctggaacttggttgactccatttcttcaagcagtctac
ctctttgtacagtatatcattatggttaatctccttatcgcatttttcaataatgtatat
ttacaagtgaaggcaatttccaatattgtatggaagtatcagcggtatcattttattatg
gcttatcatgaaaaaccagtcctgcctcctcctcttatcatcctcagccatatagtttca
ctgttttgctgtgtatgcaaaagaagaaagaaagataagacttccgatgggccaaaactt
ttcttaacagaagaagatcaaaagaaactccatgattttgaagagcagtgtgttgagatg
tactttgatgagaaagatgacaaattcaattctgggagtgaagagagaatccgggtcact
tttgaaagagtggagcagatgagcattcagattaaagaagttggagatcgtgtcaactac
ataaaaagatcattacagtctttagattctcaaattggtcatctgcaagatctctcagcc
ctaacagtagatacattgaaaacacttacagcccagaaagcttcagaagctagtaaagtg
cacaatgagatcacacgagaattgagtatttccaaacacttggctcagaatcttattgat
gatgttcctgtaagacctttgtggaagaaacctagtgctgtaaacacactgagttcctct
cttcctcaaggtgatcgggaaagtaataatccttttctttgtaatatttttatgaaagat
gaaaaagacccccaatataatctgtttggacaagatttgcccgtgataccccagagaaaa
gaattcaacattccagaggctggttcctcctgtggtgccttattcccaagtgctgtttct
cccccagaattacgacagagacgacatggggtagaaatgttaaaaatatttaataaaaat
caaaaattaggcagttcacctaatagttcaccacatatgtcctccccaccaaccaaattt
tctgtgagtaccccatcccagccaagttgcaaaagtcacttggaatccacaaccaaagat
caagaacccattttctataaagctgcagaaggggataacatagaatttggagcatttgtg
ggacacagagatagtatggacttacagaggtttaaagaaacatcaaacaaaataagagaa
ctgttatctaatgatactcctgaaaacactctgaaacatgtgggtgctgctggatatagt
gaatgttgtaagacttctacttctcttcactcggtgcaagcagaaagctgtagtagaaga
gcgtcgacggaagactctccagaagtcgattctaaagcagctttgttaccggattggtta
cgagatagaccatcaaacagagaaatgccatctgaaggaggaacattaaatggtcttgct
tctccatttaagcccgttttggatacaaattactattattcagctgtggaaagaaataac
ctgatgaggttgtcacagagtattcccttcgttcctgtacctccacgaggcgagcctgtc
acagtgtaccgtctggaggagagttctcccagtatactgaataacagcatgtcttcatgg
tctcagctaggcctctgtgccaaaattgagtttttaagtaaagaggaaatgggaggtggt
ttacgaagagcagtcaaagtgctgtgtacctggtcagagcacgatatcctgaagtcaggg
catctctatatcattaagtcatttcttcctgaggtgataaacacatggtcaagcatttat
aaagaagatacggttctacatctctgtctcagagaaatacaacaacagagagcagcacaa
aagctcacatttgcctttaatcagatgaaacccaaatccataccatattctccaaggttc
cttgaagttttcctgttgtactgccattcagcagggcagtggtttgctgtagaagagtgc
atgactggtgaatttagaaaatacaacaacaataatggtgatgaaatcattcctacaaat
actctagaagagatcatgctagcctttagccactggacctatgaatataccagaggggag
ttactggtacttgacttacaaggagtgggagaaaacttgactgacccatctgtaataaaa
gctgaagaaaaaagatcctgtgacatggtttttggccctgccaatctaggagaagatgca
ataaaaaacttcagagccaaacatcactgtaattcttgctgtcgaaagcttaaacttcca
gatttgaagaggaatgactacacgcctgataaaattatatttcctcaggatgagtcatca
gatttgaatcttcaatctggaaattccaccaaagaatcagaagcaacaaattctgttcgt
ctgatgttatag

DBGET integrated database retrieval system