KEGG   Mus musculus (mouse): 58864Help
Entry
58864             CDS       T01002                                 

Gene name
Tssk3, 1700014N07Rik, 4930594I21Rik, Stk22c, Stk22d, Tsk-3, Tssk-3, Tssk3b
Definition
(RefSeq) testis-specific serine kinase 3 (EC:2.7.11.1)
  KO
K08811  
testis-specific serine kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     58864 (Tssk3)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: CAMK group
  TSSK family
   58864 (Tssk3)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    58864 (Tssk3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
UniProt: 
Position
4; 4 D2.3
AA seq 268 aa AA seqDB search
MEDFLLSNGYQLGKTIGEGTYSKVKEAFSKKHQRKVAIKIIDKMGGPEEFIQRFLPRELQ
IVRTLDHKNIIQVYEMLESADGKIYLVMELAEGGDVFDCVLNGGPLPESRAKALFRQMVE
AIRYCHGCGVAHRDLKCENALLQGFNLKLTDFGFAKVLPKSRRELSQTFCGSTAYAAPEV
LQGIPHDSKKGDVWSMGVVLYVMLCASLPFDDTDIPKMLWQQQKGVSFPTHLGISTECQD
LLKRLLEPDMILRPSIEEVSWHPWLAST
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaggactttctactctccaatgggtatcagctgggcaagaccattggggaagggacc
tactcaaaagtcaaagaagcattttccaaaaaacatcaaagaaaagtggcaattaaaatt
atagacaagatgggagggccagaagagtttatccagagattcctgcctcgtgagctccag
attgtccgtaccctggaccacaaaaacatcatccaggtgtatgagatgctggagtcagca
gatggaaaaatctacctggtgatggaactggctgagggaggggatgtctttgactgtgtg
ctgaacggagggccacttcccgagagccgggccaaggccctcttccgccagatggttgag
gctattcgctattgccatggctgtggcgtggcccaccgggaccttaagtgtgagaacgcc
ttgttgcagggcttcaacctgaagctgaccgactttggctttgccaaggtgctacccaag
tcacgcagggagctgagccagaccttctgtggcagcacagcctatgccgcccctgaggtg
ctacagggcataccccatgatagcaagaaaggtgatgtctggagcatgggtgtggtcctg
tatgtaatgctctgtgcaagtctaccttttgatgacacagatatccccaagatgctgtgg
cagcagcagaagggggtgtccttccccactcatttgggcatctcaaccgaatgccaggac
ctgctcaagcggctcctggaaccagacatgatactccggccttcaatcgaagaagttagt
tggcacccatggctagcaagcacttga

DBGET integrated database retrieval system