KEGG   Mus musculus (mouse): 58996Help
Entry
58996             CDS       T01002                                 

Gene name
Arhgap23, A330041B18Rik
Definition
(RefSeq) Rho GTPase activating protein 23
  KO
K20315  
Rho GTPase-activating protein 21/23
Organism
mmu  Mus musculus (mouse)
Brite
Membrane trafficking [BR:mmu04131]
 Endosome - Golgi transport
  Others
   Others
    58996 (Arhgap23)
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    58996 (Arhgap23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11; 11 D
AA seq 1277 aa AA seqDB search
MVPEPISALPPDPRSPAAWSDPGSRVPSATRAHLDNSSLGMSQPRPSPGAFPHLPSESRT
PRAFPEPGSRVLPSRLECQQALSHWLSNQIPRRAGERRCPAMPPRARSASQDRLEDVTTH
HPWPCSTSQDALSQLGQEGWHRARSDDYLSRATRSAEALGPGALVSPRLERCGWASQRPS
ARTSACPSRDLTQAPPPSGLQGLDDIGYIGYRSYSPSFQRRTGLLHALSFRDSPFGGLPT
FSLAQSPASFPPEASEPPRVVRPDPSTRALEPPAEDHRDEVVLRQKPPTGRKVQLTPARQ
MNLGFGDESPEPEARGERLGRKVAPLATTEDSLASIPFIDEPTSPSIDLQAKHVPASAVV
SSAMNSAPVLGTSPSSPTFTFALSRHYSQDCSSIKAGRRSSYLLAITTERSKSCDDGLNT
FRDEGRVLRRLPSRVPSLRVLRSFFTDGSLDSWGTSEDADAPSKRHSTSDLSDATFSDIR
REGWLYYKQILTKKGKKAGGGLRQWKRVYAVLRARSLSLSKERREPGPAAAGAAAAGAGE
DEAAPVCIGSCLVDISYSETKRRHVFRLTTADFCEYLFQAEDRDDMLGWIRAIRENSRAE
GEDPGCANQALISKKLNDYRKVSHSSGPKADSSPKGSRGLGGLKSEFLKQTAVRGLRTQE
QPPGSKEDSVAAPKTPWGINIIKKNKKAAPRAFGIRLEECQPATENQRVPLIVAACCRIV
EARGLESTGIYRVPGNNAVVSSLQEQLNRGPSDINLQDERWQDLNVISSLLKAFFRKLPE
PLFTDDKYNDFIEANRIEDSRERMKTLRKLIRDLPGHYYETLKFLVGHLKTIADHSEKNK
MEPRNLALVFGPTLVRTSEDNMTDMVTHMPDRYKIVETLIQHSDWFFSDDEDKGERTPVD
DKEPQSVPNIEYLLPNIGRTVPPSDPGSDSTTCSSAKSKGSWVPKKEPYAREMLAISFIS
AVNRKRKKRREARGLGSSTDDDSEQEAHKAAVGTQEPPEGQLPGPAAEEAPGRLSPPTAP
DERPAADTRSIVSGYSTLSTMDRSVCSGTGGRRAGAGDEADDERSELSHVETDTEGGAGP
GGRLSRRPSFSSHHLMPCDTLARRRLSRSRAEAEGPGAGTARACPRGPEPPGSASSSSQE
SLRPPAAAPALGSRPSRVEALRLRLRGTADDMLAVRLRRPLSPETRRRRSSWRRHTVVVQ
SPLTDLNFNEWKELGGGGPQESVGVRPHSDNKDSGLSSLESTKARASSAASLPSGDLGAL
QGLPQRRSAAARLHQCL
NT seq 3834 nt NT seq  +upstreamnt  +downstreamnt
atggtgcctgagcccatctcagcactacccccagatccccggagtcctgctgcctggagt
gacccagggtcccgtgtcccatctgccacccgtgcccacctggacaactcttccttgggg
atgagccagccccgcccaagccctggtgcctttccccacctcccttcagagtcccggaca
ccccgtgccttcccagagcctggcagccgggtgcttcccagcagactggagtgccagcag
gctctgtcacactggctgtccaatcagataccccgcagagcgggggagagacggtgccca
gccatgccaccccgggcccgcagtgcctcccaggaccggttggaggatgtgactacccac
cacccatggccctgctccacctcccaggatgccttgagccagctgggccaggagggttgg
caccgagctcgctcagacgattacctgagccgggctacccgctctgctgaagcactgggt
ccaggagcactggtgtcccctcgtcttgaacgctgtggttgggcttcccagcgcccatct
gcccgcacctctgcttgcccttctcgggacttgacccaggcccctcccccatctggcctg
cagggcctggatgacatcgggtacattggatatcggagctatagcccatcattccagcgc
cggactggtctcttgcacgccctctccttccgggactcaccctttgggggacttcccacc
ttcagcttggcccagtctcctgcatcattcccaccagaggcctccgaaccacctagggtc
gtccggccagatcctagcacccgagccctagagcctcccgcagaggatcatcgtgatgag
gtggtcctgaggcagaagcctccaacgggtcgcaaggtccagctgaccccagcaaggcag
atgaaccttggatttggtgatgagtccccagaacccgaggccagaggggaacgcctgggg
aggaaggtagcccctctggccactacggaagactcgctggcttctattccctttattgac
gagcccaccagccccagcattgaccttcaggccaagcatgtccctgcctccgcagtggtc
tccagtgccatgaactcagcccctgtcctgggaactagcccatcctcgccaaccttcact
tttgccctcagccgccattactcccaggactgcagcagcatcaaggcaggccgccgttcc
tcctacctgctggccatcaccacggagcgctccaagtcctgtgacgatggactgaacacc
ttccgggatgagggccgagtgctccggcgccttcccagccgggtgcccagcctacgagtg
ctgcggagcttcttcacggacgggtctctagatagctggggcacctctgaagatgctgat
gccccctctaaacgacactcaacctctgacctctcagatgcaaccttcagtgatatcagg
agagaaggctggttgtattataaacagatcctcaccaagaaggggaagaaagcgggcggc
ggcctgcgccagtggaagcgcgtctatgccgtcctgcgggcgcgctcgctctcgttgagc
aaggagcggcgggagcccgggccggcggctgcgggggctgcggcggccggcgcaggtgag
gacgaggcggcgcccgtctgcatcggctcctgcctggtggacatctcctacagcgagacc
aaaaggaggcacgtgttccggctgaccaccgctgacttctgtgaatatctctttcaggct
gaggatcgggatgacatgctgggctggatcagagcgatccgggagaacagcagggccgag
ggcgaggaccccggctgtgccaaccaagctctgatcagcaagaagcttaatgactatcgc
aaagtgagccatagctctgggcccaaagccgattcctcccctaaaggctctcggggcctg
ggaggcctcaagtctgaattcctcaagcagactgcagtccgcggcctcagaactcaggag
cagcccccaggaagcaaggaagacagtgttgcagctcccaaaaccccctggggcatcaat
attatcaagaagaacaagaaggccgccccgagggcatttggaatccggttggaggagtgc
cagcctgccaccgagaaccagcgtgtccccctgatcgttgctgcctgctgccgtattgtg
gaggcccgggggctggaatcaactggcatttaccgggtacctggcaacaacgcagtggtg
tctagcctgcaggagcagctcaaccgtgggccaagtgacatcaacctgcaggatgagcgc
tggcaggacctcaatgtcatcagcagcctgctcaaggctttcttccgcaagctgccggag
cctcttttcactgatgacaaatacaatgacttcatcgaggccaatcggatagaagattcc
agggagaggatgaagacgctgcggaagctgatccgggatctcccaggacactactatgaa
acacttaaattccttgtgggccatctcaagaccattgctgaccactcagagaagaacaag
atggaaccccggaacctggctctggtcttcgggccaacattggtaaggacatctgaagac
aacatgacagacatggtgacccacatgccggaccgctacaagatcgtggagacgttgatc
cagcattctgactggttcttcagtgatgatgaggacaaaggagagagaacccctgttgat
gacaaggagccacagtcggtgcccaacatcgagtacctcctgcccaacattggcaggaca
gtgccccccagtgatccaggctcagattccaccacctgtagctcagccaagtccaagggt
tcctgggtccccaagaaagagccttacgcccgggagatgctggcgatctccttcatctct
gcggtcaaccgcaaacggaagaagcggcgggaggcgcggggcctgggcagcagcaccgac
gatgactccgagcaggaggcgcacaaggctgcggtggggacgcaggagccacccgagggg
cagctgccgggccccgcagccgaggaggcccctggtcgcctcagcccccctacggcaccc
gacgaacggcctgcggcggacacgcgctccatcgtctcgggctactccaccctgtccacc
atggaccgtagcgtgtgctcgggcaccggcgggcggcgcgcgggcgcgggcgacgaggcg
gacgacgaacgcagcgagctgagccacgtggagacggacacggaggggggcgcaggcccc
ggggggcgcctgtcgcgccggccatccttcagctcacaccatctcatgccatgcgacact
ctggcacgccgtcgcctgtctcgcagccgcgcggaggccgagggtccgggcgcgggtacg
gcccgggcgtgtccccgcggtccggagccaccgggctcggcatcgtccagcagccaggag
tcgctgcggcccccggcggccgccccggcactcggctcacgaccttcgcgcgtggaagcc
ctgcggctacgtctccgtggcaccgccgacgacatgctggccgtgcggctgcggcgccca
ctgtcgcccgagacgcggcggcgccggagtagctggcgccgccacacagtggtggtgcag
agcccgctgaccgacctcaacttcaacgagtggaaggagctgggtggagggggccctcag
gagtccgtgggcgtgcgaccgcacagcgacaataaggactctggcctcagcagcctggag
tccaccaaggcacgggcctcatccgccgcatcactgccatctggggacctaggggccctg
cagggtctgccccagcgccgctcagctgccgcccgcctccaccagtgtctgtga

DBGET integrated database retrieval system