KEGG   Mus musculus (mouse): 59014Help
Entry
59014             CDS       T01002                                 

Gene name
Rrs1, 5730466A07Rik, AA415037, D1Ertd701e, Rrr
Definition
(RefSeq) ribosome biogenesis regulator 1
  KO
K14852  
regulator of ribosome biosynthesis
Organism
mmu  Mus musculus (mouse)
Brite
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic Type
  Pre-60S particles
   Other pre-60S particles
    59014 (Rrs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1 A2; 1 2.08 cM
AA seq 365 aa AA seqDB search
MEGQRVEELLAKAEQEEAEKLQRITVHKELELEFDLGNLLASDRNPPTVLRQAGPSPEAE
LRALARDNTQLLINQLWRLPTERVEEAVVARLPEPATRLPREKPLPRPRPLTRWQQFARL
KGIRPKKKTNLVWDEASGQWRRRWGYKRARDDTKEWLIEVPGSADPMEDQFAKRTQAKKE
RVAKNELNRLRNLARAHKMQMPSSAGLHPTGHQSKEELGRAMQVAKVSTASVGRFQERLP
KEKAPRGSGKKRKFQPLFGDFAAEKKNQLELLRVMNSKKPRLDVTRATNKQMREEDQEEA
AKRRKMSQKGKRKGGRQGPSGKRKGGPPGQGEKRKGGLGSKKHSWPSALAGKKKGVPPQG
GKRRK
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggagggccagcgcgtggaggagctgctggccaaggcagagcaggaggaggcggagaag
ctgcagcgcatcacggtgcacaaggagctggagctggagttcgacctgggcaacctgctg
gcttcggaccgcaaccccccgaccgtgctgcgccaggccgggccgtcgccggaggccgag
ctgcgggccctggcgcgggacaacacgcagctgctcatcaaccagctgtggcggctgccg
accgagcgcgtggaggaggcggtggtcgcgcgcttgccggagcccgccactcgcctgccc
cgcgagaagccgctgccccgaccacggccgctcacccgctggcagcagttcgcgcgcctt
aagggaatccgtcccaagaagaagaccaacctcgtgtgggacgaggcgagtggccagtgg
cggcgccgttggggctacaagcgcgcccgggatgacactaaagaatggctgatcgaggtg
cctgggagcgccgaccccatggaagaccagttcgccaagaggactcaggccaagaaagaa
cgcgtggccaagaatgagctgaaccgtctgcggaacctggctcgcgcgcacaagatgcag
atgcccagctcagccggcctgcaccctactggacaccagagtaaggaagagctgggccgc
gccatgcaagtggccaaggtttccaccgcttcggtgggacgcttccaggagcgccttccc
aaggagaaagctccccggggctccggcaagaagaggaagtttcagcccctctttggggac
ttcgcagccgagaaaaagaaccagttggagctacttcgagtcatgaacagcaagaaacct
cggctggacgtgacgagggccaccaacaagcagatgagggaagaggaccaggaggaggct
gccaagaggaggaaaatgagccagaaaggcaagaggaaagggggccggcaaggaccttcg
ggcaagagaaagggcggcccgccgggtcagggagaaaagaggaaaggaggcttgggaagc
aaaaagcattcctggccttctgctttagctggcaagaagaaaggagtgccgccccaaggt
gggaagaggaggaagtag

DBGET integrated database retrieval system