KEGG   Mus musculus (mouse): 59021Help
Entry
59021             CDS       T01002                                 

Gene name
Rab2a, 9330148M11Rik, C80220, Rab2
Definition
(RefSeq) RAB2A, member RAS oncogene family
  KO
K07877  
Ras-related protein Rab-2A
Organism
mmu  Mus musculus (mouse)
Pathway
AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    59021 (Rab2a)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   59021 (Rab2a)
  Exosomal proteins of other body fluids (saliva and urine)
   59021 (Rab2a)
  Exosomal proteins of colorectal cancer cells
   59021 (Rab2a)
GTP-binding proteins [BR:mmu04031]
 Small (Monomeric) G-proteins
  Rab Family
   Rab2/4/14 [OT]
    59021 (Rab2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4; 4 A1
AA seq 212 aa AA seqDB search
MAYAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIW
DTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSNSNMVIMLIGNK
SDLESRREVKKEEGEAFAREHGLIFMETSAKTASNVEEAFINTAKEIYEKIQEGVFDINN
EANGIKIGPQHAATNASHGSNQGGQQAGGGCC
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggcgtacgcctatctcttcaagtacatcatcatcggcgacacaggtgttggtaaatcg
tgcttattgctacagtttacagacaagaggtttcagccggtgcatgacctcacaattggt
gtagagtttggtgctcggatgataacgattgatgggaaacagataaaactccagatctgg
gatacagcagggcaggagtcctttcgttctatcacacggtcatattacagaggtgcagcg
ggggctttactagtgtatgatattacaaggagagacacgttcaaccacttgacaacctgg
ttagaagatgcccgtcagcattccaattccaacatggtcatcatgcttattggaaataaa
agtgacttagaatctaggagagaagtgaaaaaggaagaaggtgaagcttttgcacgagag
catggacttatcttcatggaaacttctgccaagactgcgtctaatgtagaggaggcattt
attaacacagcaaaagaaatttatgaaaaaatccaagaaggggtctttgacattaataat
gaggcaaacggcattaaaattggccctcagcacgctgctaccaacgcatctcatggaagc
aaccaaggcggacagcaggcagggggaggctgctgttga

DBGET integrated database retrieval system