KEGG   Mus musculus (mouse): 59025Help
Entry
59025             CDS       T01002                                 

Gene name
Usp14, 2610005K12Rik, 2610037B11Rik, AW107924, C78769, ax, nmf375
Definition
ubiquitin specific peptidase 14 (EC:3.4.19.12)
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.4.19.12]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     59025 (Usp14)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   59025 (Usp14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
18 A1; 18 4.91 cM
AA seq 458 aa AA seqDB search
MPLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGN
IKMKNMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAA
LRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKL
EAIEDDSGRETDSSSAPAVTPSKKKSLIDQYFGVEFETTMKCTESEEEEVTKGKENQLQL
SCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKE
KESVNAKVLKDVKFPLMLDVYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNANDKNSPP
KEIKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVRRKQDEWIKFDDDKVS
IVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEEESEQ
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgccactctactctgttacagtaaaatggggaaaggagaagtttgaaggtgtagaattg
aatactgatgaacctccaatggtgttcaaagcccagctttttgcattgactggagtccag
ccagccagacaaaaagttatggtgaaaggaggaaccctgaaggatgatgactggggaaac
atcaaaatgaaaaatatggaattgccatgtggattgacaaaccttggtaacacttgttac
atgaatgctacagttcagtgtattcgttctgtgcctgaactcaaagatgcccttaaaagg
tatgcaggtgcgttgagagcttcaggagaaatggcttcagcacagtatattactgcagct
cttagagatttgtttgattccatggataaaacttcttctagtatcccacctattattctg
ctgcagtttctgcacatggcctttccacagtttgcagagaagggcgaacaagggcagtat
cttcagcaggatgctaacgaatgctggatacaaatgatgagagtcctgcaacagaaacta
gaagccatagaggatgattctggtagagagacggattcttcatctgcaccagcggtgaca
ccttctaaaaagaaaagcttaattgatcaatattttggtgttgagtttgaaactaccatg
aaatgtacagaatctgaagaagaagaggtcaccaaaggaaaggaaaatcaacttcaactt
agttgtttcattaaccaggaagtgaagtatcttttcacagggctgaaattgcgacttcag
gaagaaattactaaacagtctccaacactgcagagaaatgctttgtacatcaaatcttct
aagatcagccggctacctgcttacttaactattcaaatggttcgatttttttataaagag
aaagaatctgtgaacgccaaagttcttaaggatgttaagtttcctcttatgttggatgtg
tatgaactctgcacaccagaacttcaagagaaaatggtctcttttcggtcaaaattcaag
gatctagaagataaaaaagtgaatcagcaaccaaatgcaaatgacaagaatagtcctccg
aaagagattaagtatgaacccttttcatttgctgacgatattggctccaataattgtggc
tactatgacttacaagcagtgttaactcaccagggaagatctagttcttcaggtcattat
gtatcatgggtgagaagaaaacaagatgaatggatcaaatttgatgatgataaggtcagc
attgtaaccccagaagatattctgcggctgtctggtggtggagactggcacattgcttat
gttctactttatgggcctcgaagagttgaaataatggaagaagaaagtgaacagtaa

DBGET integrated database retrieval system