KEGG   Mus musculus (mouse): 59287Help
Entry
59287             CDS       T01002                                 

Gene name
Ncstn, 9430068N19Rik, AA727311, Aph2, D1Dau13e, Kiaa0253, Nct, mKIAA0253
Definition
(RefSeq) nicastrin
  KO
K06171  
nicastrin
Organism
mmu  Mus musculus (mouse)
Pathway
Notch signaling pathway
Alzheimer's disease
Module
Notch signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    59287 (Ncstn)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    59287 (Ncstn)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1 H3; 1 79.54 cM
AA seq 708 aa AA seqDB search
MATTRGGSGPDPGSRGLLLLSFSVVLAGLCGGNSVERKIYIPLNKTAPCVRLLNATHQIG
CQSSISGDTGVIHVVEKEEDLKWVLTDGPNPPYMVLLEGKLFTRDVMEKLKGTTSRIAGL
AVTLAKPNSTSSFSPSVQCPNDGFGIYSNSYGPEFAHCKKTLWNELGNGLAYEDFSFPIF
LLEDENETKVIKQCYQDHNLGQNGSAPSFPLCAMQLFSHMHAVISTATCMRRSFIQSTFS
INPEIVCDPLSDYNVWSMLKPINTSVGLEPDVRVVVAATRLDSRSFFWNVAPGAESAVAS
FVTQLAAAEALHKAPDVTTLSRNVMFVFFQGETFDYIGSSRMVYDMENGKFPVRLENIDS
FVELGQVALRTSLDLWMHTDPMSQKNESVKNQVEDLLATLEKSGAGVPEVVLRRLAQSQA
LPPSSLQRFLRARNISGVVLADHSGSFHNRYYQSIYDTAENINVTYPEWQSPEEDLNFVT
DTAKALANVATVLARALYELAGGTNFSSSIQADPQTVTRLLYGFLVRANNSWFQSILKHD
LRSYLDDRPLQHYIAVSSPTNTTYVVQYALANLTGKATNLTREQCQDPSKVPNESKDLYE
YSWVQGPWNSNRTERLPQCVRSTVRLARALSPAFELSQWSSTEYSTWAESRWKDIQARIF
LIASKELEFITLIVGFSTLVFSLIVTYCINAKADVLFVAPREPGAVSY
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atggctacgactaggggcggctctgggcctgacccaggaagtcggggtcttcttcttctg
tctttttccgtggtactggcaggattgtgtgggggaaactcagtggagaggaaaatctac
attcccttaaataaaacagctccttgtgtccgcctgctcaacgccactcatcagattggc
tgccagtcttcaattagtggggatacaggggttatccatgtagtggagaaagaagaagac
ctgaagtgggtgttgaccgatggccccaaccccccttacatggttctgctggagggcaag
ctcttcaccagagatgtaatggagaagctgaagggaacaaccagtagaatcgctggtctt
gccgtgactctagccaagcccaactcaacttcaagcttctctcctagtgtgcagtgccca
aatgatgggtttggtatttactccaactcctacgggccagagtttgctcactgcaagaaa
acactgtggaatgaactgggcaacggcttggcttatgaagactttagtttccccatcttt
cttcttgaagatgagaacgaaaccaaggtcatcaagcagtgctatcaagatcacaacctg
ggtcagaatggctctgcaccaagcttcccattgtgtgctatgcagctcttctcacacatg
cacgccgtcatcagcactgccacctgcatgcggcgcagcttcatccagagcaccttcagc
atcaacccagaaatcgtctgtgaccccttatccgactacaacgtatggagcatgcttaag
cctataaatacatctgtgggactagaacctgacgtcagggttgtggttgcggccacacgg
ctggatagccggtcctttttctggaatgtggccccaggggctgaaagtgctgtagcctcc
tttgtcactcagctggctgcagctgaagctttgcacaaggcacctgatgtgaccactcta
tcccgaaatgtgatgtttgtcttcttccagggggaaacttttgactacattggcagctca
cggatggtctatgatatggagaacggcaagtttcccgtgcggctcgagaacattgactcc
ttcgtggagctgggacaggtggccctaagaacttcactagatctctggatgcacacagat
cccatgtctcagaaaaatgagtctgtgaaaaaccaggtggaggatcttctggccactctg
gagaagagcggtgctggtgtccctgaagttgtcctgaggagactggcccagtcccaggcc
cttccaccttcgtctctacaacgatttcttcgggctcgaaacatctctggcgtggtcctg
gctgaccactctggctccttccacaatcggtattaccagagcatttatgacacggctgag
aacattaatgtgacctatcctgagtggcagagcccagaagaggacctcaactttgtgaca
gacactgccaaggcactggcgaatgtggccacagtgctggcgcgtgcactgtatgagctt
gcaggaggaaccaacttcagcagctccatccaggctgatccccagacagttacacgtctg
ctctatgggttcctggttagagctaacaactcatggtttcagtcgatcttgaaacatgac
ctaaggtcctatttggatgacaggcctcttcaacactacatcgccgtctccagccctacc
aacacgacttacgttgtgcagtacgccttggcaaacctgactggcaaggcgaccaacctc
acccgagagcagtgccaggatccaagtaaagtcccaaatgagagcaaggatttatatgaa
tactcgtgggtacaaggcccttggaattccaacaggacagagaggctcccacagtgtgtg
cgctccacagtgcgactggccagggccttgtcccctgcctttgaactgagtcagtggagc
tccacagaatactctacgtgggcggagagccgctggaaagacatccaagctcggatattc
ctaattgccagcaaagagcttgagttcatcacgctgatcgtgggcttcagcacccttgtc
ttctccctcatcgtcacctactgcatcaatgccaaagccgacgtccttttcgttgctccc
cgagagccaggagctgtgtcttactga

DBGET integrated database retrieval system