KEGG   Mus musculus (mouse): 60525Help
Entry
60525             CDS       T01002                                 

Gene name
Acss2, 1110017C11Rik, ACAS, Acas1, Acas2, AceCS1, Acs1
Definition
acyl-CoA synthetase short-chain family member 2 (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    60525 (Acss2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    60525 (Acss2)
   00620 Pyruvate metabolism
    60525 (Acss2)
   00640 Propanoate metabolism
    60525 (Acss2)
Enzymes [BR:mmu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     60525 (Acss2)
Lipid biosynthesis proteins [BR:mmu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   60525 (Acss2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2; 2 H2
AA seq 701 aa AA seqDB search
MGLPEERRKSGSGSRAREETGAEGRVRGWSPPPEVRRSAHVPSLQRYRELHRRSVEEPRE
FWGNIAKEFYWKTACPGPFLQYNFDVTKGKIFTEWMKGATTNICYNVLDRNVHEKKLGDK
VAFYWEGNEPGETTKITYRELLVQVCQFSNVLRKQGIQKGDRVAIYMPMILELVVAMLAC
ARLGALHSIVFAGFSAESLCERILDSSCCLLITTDAFYRGEKLVNLKELADESLEKCREK
GFPVRCCIVVKHLGRAELGMNDSPSQSPPVKRPCPDVQICWNEGVDLWWHELMQQAGDEC
EPEWCDAEDPLFILYTSGSTGKPKGVVHTIGGYMLYVATTFKYVFDFHPEDVFWCTADIG
WITGHSYVTYGPLANGATSVLFEGIPTYPDEGRLWSIVDKYKVTKFYTAPTAIRMLMKFG
DDPVTKHSRASLQVLGTVGEPINPEAWLWYHRVVGSQRCPIVDTFWQTETGGHMLTPLPG
ATPMKPGSASFPFFGVAPAILNESGEELEGEAEGYLVFKQPWPGIMRTVYGNHTRFETTY
FKKFPGYYVTGDGCRRDQDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVV
GHPHPVKGECLYCFVTLCDGHTFSPTLTEELKKQIREKIGPIATPDYIQNAPGLPKTRSG
KIMRRVLRKIAQNDHDLGDTSTVADPSVINHLFSHRCLTTQ
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atggggcttcccgaggagcggcgcaagagcggcagtggaagccgggctcgtgaggagacc
ggcgccgagggccgggtgcggggttggtccccgccgccggaggtcagacgctcggcgcac
gtcccctctctgcagcgctaccgcgagctgcaccggcgttctgtggaggagccacgggag
ttttggggaaacattgccaaggaattttactggaaaaccgcatgccctggcccattcctc
cagtacaactttgatgtgactaaagggaaaatattcactgagtggatgaaaggagcaact
acaaacatctgctacaacgtgctggatcgaaatgtccatgagaaaaaacttggcgacaaa
gttgctttttactgggagggcaatgagccaggggagaccaccaagatcacataccgtgaa
ctcctggtccaggtgtgtcagttcagcaatgttctccgtaaacagggcattcagaagggt
gaccgagtggccatctacatgcctatgatcttggaacttgtggtggctatgctggcatgc
gctcgccttggagctttgcactccattgtgtttgcaggcttctctgcagagtctctctgt
gaaaggatcttggattccagttgctgcctgctcatcactacagatgccttctacaggggg
gaaaaacttgtgaacctgaaggagctggctgatgagtccttggagaagtgccgagagaag
ggcttcccagtgagatgctgcattgtggtcaaacatctggggcgggcagagctgggcatg
aatgactcccccagccagtccccaccagttaagaggccatgtccagatgtccagatctgc
tggaacgaaggggttgacttatggtggcatgaactcatgcagcaggcaggagacgagtgt
gagcctgagtggtgtgatgctgaggacccactcttcatcttgtacaccagtggctccaca
ggcaaacctaagggtgtggtgcacacaattggaggctatatgctctatgtggctacaact
ttcaagtatgtgtttgatttccacccggaagatgtgttctggtgcacagcagacatcggc
tggatcactggtcattcctatgtcacctatgggccactggctaatggtgccactagtgtt
ttgtttgaggggatccccacatacccagatgaagggcgcttgtggagcattgtggacaaa
tacaaggtgaccaagttctacacggcaccaacagccatccggatgctcatgaagtttgga
gatgatcctgtcaccaagcatagccgggcatccctgcaggtgctgggcacagtaggtgaa
cccatcaaccctgaagcctggctatggtaccaccgggtagtaggttcccagcgctgcccc
attgtagacaccttctggcaaacagaaacaggtggccatatgctgacccctctccctggc
gccacacccatgaaacctggttctgcttctttcccattcttcggtgtagcgcctgcaatc
ctgaatgagtccggggaggagctggaaggggaagctgaaggttatctggtgttcaagcag
ccctggccagggatcatgcgcacagtctatgggaaccacacacggtttgagaccacctac
tttaagaagttccctggctactatgtgaccggagatggctgccgacgggatcaggatggc
tattactggatcacgggcaggattgatgacatgctcaatgtgtctggacatctcctgagt
acagcagaggtggaatcggcacttgtggaacacgaggctgtcgcagaggcagctgtggtg
ggccaccctcatcctgtgaagggcgaatgcctctactgctttgttaccttgtgtgatggc
cataccttcagccccacactcacagaggaactcaagaagcagattagagaaaagattggc
cccattgccacaccagactacatccagaatgcacctggcttgcctaaaacacgctcaggg
aaaatcatgaggcgagttctccggaagattgctcagaatgaccatgacctgggggataca
tctacggtggctgacccatctgtcatcaaccatctcttcagtcaccgctgcctgaccacc
cagtga

DBGET integrated database retrieval system