KEGG   Mus musculus (mouse): 60613Help
Entry
60613             CDS       T01002                                 

Gene name
Kcnq4
Definition
(RefSeq) potassium voltage-gated channel, subfamily Q, member 4
  KO
K04929  
potassium voltage-gated channel KQT-like subfamily member 4
Organism
mmu  Mus musculus (mouse)
Pathway
Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Nervous system
   04725 Cholinergic synapse
    60613 (Kcnq4)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  K+ channel, KCNQ, Kv7.x (KQT-like)
   60613 (Kcnq4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4; 4 D2.2
AA seq 696 aa AA seqDB search
MAEAPPRRLGLGPPPGDAPRAELVALTAVQSEQGEAGGGGSPRRLGLLGSPLPPGAPLPG
PGSGSGSACGGQRSSAAQKRYRRLQNWVYNVLERPRGWAFVYHVFIFLLVFSCLVLSVLS
TIQEHQELANECLLILEFVMIVVFGLEYIIRVWSAGCCCRYRGWQGRFRFARKPFCVIDF
IVFVASVAVIAAGTQGNIFATSALRSMRFLQILRMVRMDRRGGTWKLLGSVVYAHSKELI
TAWYIGFLVLIFASFLVYLAEKDANSDFSSYADSLWWGTITLTTIGYGDKTPHTWLGRVL
AAGFALLGISFFALPAGILGSGFALKVQEQHRQKHFEKRRMPAANLIQAAWRLYSTDTSR
AYLTATWYYYDSILPSFRELALLFEHIQRARNGGLRPLEVRRAPVPDGAPSRYPPVATCH
RPGSASFCPGESSRMGIKDRIRISSSQKRTGPSKQHLAPPPIPTSPSSEQVGEASSPSKV
QKSWSFNDRTRFRASLRLKPRCSAEEGPSEEVAEEKSYQCELTVDDVMPAVKTVIRSVRI
LKFLVAKRKFKETLRPYDVKDVIEQYSAGHLDMLGRIKSLQARVDQIVGRGPGDRKTREK
GDKGPSDTEAVDEISMMGRVVKVEKQVQSIEHKLDLLLGFYSRCLRSGTSASLGTVQVPL
FDPDITSDYHSPVDHEDISVSAQTLSISRSVSTNMD
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggcccccccgcgccgcctcggcctgggccccccgcccggggacgccccccgc
gcggagttggtggcgctcacggccgtgcagagtgaacagggcgaggcgggcgggggcggc
tctccgcgtcgcctcggccttctgggcagccccctgccgccgggcgcgcccctccctggg
ccgggctccggctcgggctccgcctgcggcggccagcgctcctccgccgcgcagaagcgc
taccgccgcctgcagaactgggtctacaacgtgctggagcggccccgcgggtgggccttc
gtctaccacgtcttcatatttttgctagtcttcagctgcctggtgctgtctgtactgtcc
accatccaggagcaccaggaacttgccaacgagtgtctccttatcttggaattcgtgatg
attgtggtctttggcttggagtatataatccgtgtctggtcggccggatgctgttgtcgc
tacagaggatggcagggacgctttcgcttcgccaggaaacccttctgtgtcatcgacttc
atcgtgttcgtggcctcggtggcagtgatagctgcgggcacacaaggcaacatctttgct
acgtccgcgttgcgcagtatgcgcttcctacagatcctgcgcatggtgcgtatggatcgc
cgcggtggcacctggaagctgttgggatccgtggtctatgcgcacagtaaggagctgatc
accgcctggtacatcgggttcctggtgctcatctttgcctctttcctggtctacctggct
gagaaggatgccaactctgacttctcctcctatgccgactcgctctggtgggggacgatc
acactgacgaccattggctatggtgacaagacgccacatacatggctgggcagggttctg
gctgccggcttcgccttactgggcatctccttctttgccctgcctgccggcatcctgggc
tctggctttgccctgaaggtccaggagcagcacaggcagaagcactttgagaagcgcagg
atgccagcagctaatctcatccaggctgcgtggcgcctgtactccacggacacaagccgg
gcctatttgacagccacctggtattactatgacagcattctcccatctttcagagagctg
gccctcttgtttgagcacatacaacgggcccgcaatgggggcttacggcccctggaggtg
aggcgggcgccagtacctgatggagcgccctctcgctacccgcccgttgccacctgccac
cggccaggcagtgcctccttctgccctggggaaagcagccggatgggcatcaaagaccga
atccgcataagcagctcccagaagcggacaggcccctccaagcagcatctggcccctccg
ccgattcccacctcgccaagcagtgagcaggtgggcgaggcatccagccccagcaaggtg
cagaaaagctggagcttcaatgaccgcacccgcttccgggcctctctaagactcaagcct
cgctgctctgctgaggagggcccctcagaggaagtggccgaggagaagagctaccagtgt
gagcttacggtggatgatgtcatgcctgctgtgaagacggtcatccgttctgtcaggatt
ctgaagttcctggtagccaaaaggaaattcaaggagacgctgcggccatatgatgtgaag
gatgtcattgagcagtattcagcaggacacctggacatgctgggacgaatcaagagcctg
caagcccgggtggaccaaattgtgggtcggggccctggggaccgcaagactcgggagaag
ggcgataagggtccttcagacacggaggcagtggatgaaatcagcatgatggggcgcgta
gtcaaggtggaaaagcaggtgcagtccatcgaacataagttggatctgctgctgggcttc
tactcgcgctgcctccgctctggcacctcggccagcctgggcactgtgcaagtgccgctc
ttcgaccccgacatcacctcggactaccacagccctgtagaccacgaggacatctctgtc
tccgcacagacgctcagcatctctcgctcagtcagcaccaacatggactga

DBGET integrated database retrieval system