KEGG   Mus musculus (mouse): 623474Help
Entry
623474            CDS       T01002                                 

Gene name
Rad54b, E130016E03Rik
Definition
RAD54 homolog B (S. cerevisiae)
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
mmu  Mus musculus (mouse)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    623474 (Rad54b)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     623474 (Rad54b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4 A1; 4
AA seq 886 aa AA seqDB search
MRRSAAPSQVQGKSFKKTRFIPPGRSNADVSKEITKMSPDPKLFQGAEQSQNDPGVCSSN
PCPSEGIPREVGDGTRVDPLPPVHSASKEITESKAQEEEASSLLKYFSVVWCKASKKKHK
KWEGDAILIVRGRSFTLKDLEGKDIGRGIGYKFKDLENVEEGQTLIIGGKEIEILGTISS
DDFNSGKCFQHGSGSPAVPSSQAARKCFSNPFKSVCQSTQAQGKRWNDCRPRHNPCTPNA
LVMPRPDENHQRMFNRHCSPIVDVVIDPHLVHHLRPHQKDGIIFLYECVMGMRAVGKCGA
ILADEMGLGKTLQCISLIWTLQCQGPYGGKPVIKKTLIVTPGSLVNNWRKEFQKWLGSER
IKIFTVDQDHKVEEFINSTFHSVLIISYEMLLRSLDQIKTIPFGLLICDEGHRLKNSSIK
TTTALSSLSCEKTVILTGTPVQNDLQEFFALVDFVNPGILGSLSSYRKIYEEPIIISREP
SSSKEERELGERRATELTRLTGRFILRRTQEVINKYLPPKIENVVFCRPGALQIELYRKL
LRSQSVRFCLQGLLENSAHLICIGALKKLCNHPCLLFSSVKGKEFSSSCEENEERNLCQG
LLSVFPAGYNPLQFSEEESGKLQVLVKLLAVIHELRPTEKVILVSNYRQTLNVLEEVCKR
HGYACARLDGQTPVSQRQHIVDSFNSKYSTDFIFLLSSKAGGVGLNLIGGSHLILYDIDW
NPATDIQAMSRVWRDGQKHPVHIYRLLTTGTIEEKIYQRQISKQGLSGAVVDLTRSSEHI
QFSVEELKNLFTLHESSHCVTHDLLDCECTGEKGHTEDASEGPVASRQCQFGPQKSDALR
PLSMSQLKQWKHFSGDHLNLPDPFLERIRENVSFFFQNITNQAPAV
NT seq 2661 nt NT seq  +upstreamnt  +downstreamnt
atgagaagatctgcagcaccaagtcaggtgcagggaaagtcctttaaaaaaacaagattc
atacctccaggaagaagtaatgcagatgtgagtaaggagatcacaaagatgagtccagat
ccaaaactgtttcagggtgctgaacagtcacaaaatgatccaggtgtatgcagttcaaat
ccttgccccagtgagggaatccctagggaagtgggtgatgggactagagtagatccactt
cctccagttcattcggcctctaaagaaatcacagagtccaaggcacaagaagaggaagct
agcagcttgcttaaatatttcagtgttgtttggtgtaaagcttcaaagaaaaaacacaaa
aagtgggaaggcgatgctattcttattgtaagaggaaggtccttcacattgaaagatttg
gaaggaaaagatattggaagaggcattggatacaaattcaaggaccttgagaatgtagaa
gagggccaaacattgataattggtgggaaagaaatagaaatcctggggacaatctcttct
gatgacttcaacagtggcaagtgttttcagcacggaagtggaagtcctgctgtcccaagt
tctcaggctgccaggaaatgcttttctaaccctttcaaaagtgtgtgtcagtcaacgcaa
gcacagggaaaaagatggaatgactgcagaccgcgccataacccgtgcacaccaaatgcc
cttgttatgccgcgcccagacgagaatcaccagcggatgtttaataggcactgctctcct
attgtggatgtcgtgatagaccctcaccttgtacaccacctccgaccacatcagaaagac
ggaatcatcttcctctatgagtgtgtgatgggaatgagagcagttggcaaatgtggcgct
attcttgctgatgaaatgggcttagggaaaacgttgcagtgtatctcgctcatctggacc
ctacagtgtcaggggccctatggcggcaagccagtaataaagaagacactcattgttacc
cctggaagcctggtgaataattggaggaaagaatttcaaaaatggctgggaagtgaaagg
atcaagatattcaccgttgatcaggaccataaagtcgaggagtttatcaattctacattt
cattcagttcttatcatcagttatgaaatgttacttcgttccctagatcaaattaagact
atcccatttggccttctgatctgtgatgagggacaccgtttgaagaacagcagcatcaag
acaacgacggccctttctagcctctcctgtgagaagacagtaattctcactggtacccca
gttcagaatgatttgcaagagttttttgcattagttgattttgttaatccaggaatatta
gggtctctgtcgtcttacaggaaaatatatgaagaacccatcattatatcaagagagcct
tcttcttctaaggaagagagagagttaggggagagaagagcaactgagctcacgcgcctc
actggacgttttatccttagaagaactcaggaagtcatcaataaatatctcccgcctaag
atagagaatgtagtcttttgccgaccaggagcattgcagattgaactttaccgaaagctg
ctgcgctctcagtctgtgaggttctgtttgcaaggactattggaaaatagtgctcacctc
atctgcataggggccctaaagaagctgtgcaaccacccttgcctcttgttcagctctgtg
aagggcaaagaatttagctcaagttgtgaggaaaatgaagaaagaaatctatgccaaggc
ttgctgtctgtgttccctgctggctacaaccctctgcagttctctgaggaagagtcagga
aaactacaggtgttagtcaagctcctggcagtgatccatgaacttcgtcccactgagaaa
gtgattttggtatccaactacagacaaaccttgaatgttctagaagaagtatgtaagcgt
catggatatgcttgtgcaagacttgatggccaaacaccagtctctcaaaggcagcacatt
gttgatagtttcaatagtaaatactctactgattttatttttttattaagttcaaaagct
ggtggtgtgggacttaatctcattggaggatctcacttaattctctatgatatcgattgg
aacccagctactgatatccaggccatgtctagagtatggagagatggtcagaagcatcct
gtacatatttacagactcctgactacaggtacaatagaggaaaagatctatcaaaggcag
atcagtaagcaaggcctttctggggcagtggtagacctaaccagatcatctgaacatatc
cagttttcagtggaagagcttaaaaacttgttcacactacatgaaagttcacattgtgtc
actcatgacctgcttgactgtgagtgcacaggggaaaaaggtcacaccgaggatgcgtcc
gaaggccccgtcgcctcccgacagtgtcagttcggccctcagaagtctgacgccttgaga
cctctgtccatgtcacagctgaagcagtggaaacatttttctggagaccatttaaatctt
ccagatccatttctcgaaagaatacgggaaaatgtgtcgttctttttccagaatataacc
aaccaagctcctgccgtctaa

DBGET integrated database retrieval system