KEGG   Mus musculus (mouse): 625530Help
Entry
625530            CDS       T01002                                 

Gene name
Usp17le, DUB-3, Dub3, Dub6, EG625530, Gm6596, USP17, USP17-E, Usp17l2
Definition
ubiquitin specific peptidase 17-like E (EC:3.4.19.12)
Orthology
K11845  
ubiquitin carboxyl-terminal hydrolase 17 [EC:3.1.2.15]
Organism
mmu  Mus musculus (mouse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Position
7 E3; 7 55.69 cM
AA seq 540 aa AA seqDB search
MVVSLSFPEETGGENLPSAPLEDSSKFFEEVFGDMVVALSFPEADPALSSPDAPELHQDE
AQVVEELTTNGKHSLSWESPQGPGCGLQNTGNSCYLNAALQCLTHTPPLADYMLSQEHSQ
TCCSPEGCKMCAMEAHVTQSLLHSHSGDVMKPSQILTSAFHKHQQEDAHEFLMFTLETMH
ESCLQVHRQSDPTPQDTSPIHDIFGGWWRSQIKCLHCQGTSHTFDPFLDVPLDISSAQSV
NQALWDTGKSEELLGENAYYCGRCRQKMPASKTLHVHIAPKVLLLVLKRFSAFTGNKLDR
KVSYPEFLDLKPYLSEPTGGPLPYALYAVLVHDGATSNSGHYFCCVKAGHGKWYKMDDTK
VTRCDVTSVLNENAYVLFYVQQTDLKQVSIDMPEGRVHEVLDPKYQLKKSRRKKRKKQCH
CTDDAGEACENREKRAKKETSLGEGKVPQEVNHEKAGQKHGNTKLVPQEQNHQRAGQNLR
NTEVELDLPVDAIVIHQPRSTANWGTDAPDKENQPWHNGDRLLTSQGLMSPGQLCSQGGR
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atggtggtttctctttccttcccagaagagactggaggggaaaatcttccttctgctccc
ttagaagactccagcaagttctttgaagaggtctttggagacatggtggttgctctttcc
ttcccagaagcagatccagcactatcatctcctgatgccccagagctgcatcaggatgaa
gctcaggtggtggaggagctaactaccaatggaaagcacagtctgagttgggagagtccc
caaggaccaggatgcgggctccagaacacaggcaacagctgctacctgaacgcagccctg
cagtgcttgacacacacaccacctctagctgactacatgctgtcccaggagcacagtcaa
acctgttgttccccagaaggctgtaagatgtgtgctatggaagcccatgtgacccagagt
ctcctgcactctcactcgggggatgtcatgaagccctcccagattttgacctctgccttc
cacaagcaccagcaggaagatgcccatgagtttctcatgttcaccttggaaacaatgcat
gaatcctgccttcaagtgcacagacaatcagatcccacccctcaggatacgtcacccatt
catgacatatttggaggctggtggaggtctcagatcaagtgtctccattgccagggcacc
tcacataccttcgatcccttcctggatgtccccctggatatcagctcagctcagagtgta
aatcaagccttgtgggatacagggaagtcagaagagctacttggagagaatgcctactac
tgtggtaggtgtagacagaagatgccagcttctaagaccctgcatgttcatattgctcca
aaggtactcctgctagtgttaaagcgcttctcagccttcacgggtaacaagttagacaga
aaagtaagctacccggagttccttgacctgaagccatacctgtctgagcctactggagga
cctttgccttatgccctctatgccgtcctggtccatgatggtgcgacttctaacagtgga
cattacttctgttgtgtcaaagctggtcatgggaagtggtacaagatggatgatactaag
gtcaccaggtgtgatgtgacttctgtcctgaatgagaatgcctatgtgctcttctatgtg
cagcagaccgacctcaaacaggtcagtattgacatgccagagggcagagtacatgaggtt
cttgaccctaaataccagctgaagaaatcccggagaaaaaagcgtaagaagcaatgccat
tgcacagatgatgccggagaggcatgcgaaaacagggagaagagagcaaagaaagaaacc
tccttaggggaggggaaagtgcctcaggaagtgaaccacgagaaagctgggcagaaacat
gggaataccaaactcgtgcctcaggaacagaaccaccagagagctgggcagaacctcagg
aatactgaagttgaacttgatctgcctgttgatgcaattgtgattcaccagcccagatcc
acagcaaactggggcacggatgctccagacaaagagaatcaaccctggcacaatggtgac
aggctcctcacctctcagggcctcatgagccctgggcagctctgtagtcagggtgggaga
tga

DBGET integrated database retrieval system