KEGG   Mus musculus (mouse): 635253Help
Entry
635253            CDS       T01002                                 

Gene name
Usp51, AV136873
Definition
ubiquitin specific protease 51 (EC:3.1.2.15)
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     635253 (Usp51)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   635253 (Usp51)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     635253 (Usp51)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
X F3; X
AA seq 661 aa AA seqDB search
MRGTQGAQEMKPELWPEPKPTSENLTSRGSGSYEKVLPSIPAACHTSSSSVCPRRKPRPR
PQPRSRSRGGRGLKAPPPPPAKPPPPPPAPPPPPLPKQRSVAWRNSRRRSRPGPRPQTRK
SYSSDHGSSRDSDGSENSLLEVGSNKGPTGCCHVESFKVAKNWQRNLRMIYQRFIWSGTP
ETRKRKAKSCICQICSTHKNRLHSCLSCVFFGCFTDKHIHIHAETTQHNLAVDLCHGVIY
CFMCRDYVYDKDIEKIAKETKEKILGLLSSPTGDASYQQLMASEVEENQLTCESKDQETS
LVKPKKKRRKKTMYYTVGFRGLINLGNTCFMNCIVQVLTHIPLLKEFFLSNKHKCMMTSP
SLCLVCEMSLLFQAMYSGNQSPHIPYKLLHLIWIHAEHLAGYRQQDAQEFLIAILDVLHR
HSRDDGIDQEGNSNCCNCIIDHIFTGSLQSDLTCQVCHGVSTTIDPCWDISLDLPGPYTP
GRASSSTSSRDGQKPRVISLTDCLKWFTRPEDLGSSAKIKCSQCQSYQESTKQLTMKKLP
IVACFHLKRFEHLGKQRRKINSFISFPLELDMTPFLASTKESIMKGQPLTECVPSENKYS
LFAVINHHGTLESGHYTSFVRQEKDQWFSCDDAVVTKATMEELLNSEGYLLFYHRQDIEK
E
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgcggggtacacagggagcccaggagatgaagccggagctgtggccggagcccaagccc
acgtcggagaacttaacaagtaggggcagtggcagctatgagaaggtgctcccttctatc
ccggctgcttgtcacaccagctccagctcggtttgcccgcgccgcaagccccgccctcgg
ccccagcccaggtcccgctccaggggagggcgtgggctcaaggccccacccccgcctccc
gccaaacctccgcctcccccgccagcgccgccacctccacccctgcccaagcagcggtcg
gtggcctggcgcaattccagacgtagatccaggcctggacccagaccccaaacacggaaa
agctactctagtgaccatggctcctctagggattcagatggctcagagaacagtttactg
gaggtagggtctaataagggtcccacaggctgctgtcatgtagagagctttaaagtagct
aaaaactggcagagaaacctgcggatgatctatcagcgtttcatttggagtggaaccccg
gagactaggaaacgtaaggcaaagtcatgcatctgtcaaatatgtagtactcacaagaac
agactccactcttgtctgtcctgtgtattttttggatgctttactgacaaacatattcac
attcatgccgaaacaacgcaacacaatttagcagtagacctctgtcatggggttatatat
tgctttatgtgtagggattatgtatatgacaaagatatagaaaagatcgccaaagaaaca
aaagaaaaaattctgggactgttatcatcccctacaggagatgcatcttatcagcagttg
atggcatctgaggtggaagaaaaccaattaacctgcgagtcaaaagatcaggagaccagt
ttggtaaaacccaagaaaaagaggaggaaaaagacaatgtattatactgtaggcttcaga
ggattaattaatcttggtaatacttgctttatgaattgtattgtccaagtacttactcac
attccgctactgaaagagttcttcctttcaaataagcacaaatgtatgatgacaagcccc
agcttgtgtttagtctgcgagatgtctttactttttcaagctatgtactcggggaaccaa
agtcctcatattccctataaattactacacctgatatggatccatgcagagcatctagca
ggctacagacaacaggatgctcaggagtttcttattgccatattggatgtgttgcataga
cacagcagagatgatggtatcgaccaggaaggtaactccaactgctgtaattgcatcata
gatcacatctttacaggtagtctgcagtcagatttaacatgtcaagtttgtcatggtgtc
tctactaccatagacccatgctgggacattagcttggatttgcctgggccttatactcca
gggagggctagtagtagcacatcgagtagggatggccagaagccacgagtcatctcactt
acagattgcctgaagtggtttacaaggcccgaagacctgggtagcagtgccaaaatcaaa
tgcagtcaatgccaaagctaccaggaatctaccaaacagctcacaatgaagaaattaccg
attgtggcctgctttcacctgaaaagatttgaacatttaggcaaacagagacgaaagatt
aatagttttatctcgtttcctttggagctggacatgaccccgttcttggcttctactaaa
gaaagcataatgaaaggccagccattaacagagtgtgtacccagtgagaataagtattct
ttgtttgcagtaattaaccaccatggaactttggaaagtggccattacaccagttttgtc
cgacaggaaaaagaccagtggttcagctgtgatgatgctgtagtcaccaaggctacaatg
gaagaattactcaatagtgaagggtatctactgttctatcataggcaagatatagagaaa
gaataa

DBGET integrated database retrieval system