KEGG   Mus musculus (mouse): 63857Help
Entry
63857             CDS       T01002                                 

Gene name
Bcmo1, Bcdo, Bcdo1, CMO1, Cmoi, beta-CD, betaCMOOX
Definition
beta-carotene 15,15'-monooxygenase (EC:1.14.99.36)
Orthology
K00515  
beta-carotene 15,15'-monooxygenase [EC:1.14.99.36]
Organism
mmu  Mus musculus (mouse)
Pathway
Retinol metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    63857 (Bcmo1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.36  beta-carotene 15,15'-monooxygenase
     63857 (Bcmo1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
8 E1; 8
AA seq 526 aa AA seqDB search
MEIIFGQNKKEQLEPVQAKVTGSIPAWLQGTLLRNGPGMHTVGESKYNHWFDGLALLHSF
SIRDGEVFYRSKYLQSDTYIANIEANRIVVSEFGTMAYPDPCKNIFSKAFSYLSHTIPDF
TDNCLINIMKCGEDFYATTETNYIRKIDPQTLETLEKVDYRKYVAVNLATSHPHYDEAGN
VLNMGTSVVDKGRTKYVIFKIPATVPDSKKKGKSPVKHAEVFCSISSRSLLSPSYYHSFG
VTENYVVFLEQPFKLDILKMATAYMRGVSWASCMSFDREDKTYIHIIDQRTRKPVPTKFY
TDPMVVFHHVNAYEEDGCVLFDVIAYEDSSLYQLFYLANLNKDFEEKSRLTSVPTLRRFA
VPLHVDKDAEVGSNLVKVSSTTATALKEKDGHVYCQPEVLYEGLELPRINYAYNGKPYRY
IFAAEVQWSPVPTKILKYDILTKSSLKWSEESCWPAEPLFVPTPGAKDEDDVPCRPSRDC
GVQGPHRKSHCQLSIACVPEISAFGRQTEDNQGSTVILRYTENLNY
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggagataatatttggccagaataagaaagaacagctggagccagttcaggccaaagtg
acaggcagcattccagcatggctgcaggggaccctgctccgaaacgggcccgggatgcac
acagtgggagagagcaagtacaaccattggtttgatggcctggcccttctccacagtttc
tccatcagagatggggaggtcttctacaggagcaaatacctgcagagtgacacctacatc
gccaacattgaggccaacagaatcgtggtgtctgagttcggaaccatggcctacccggac
ccctgcaaaaacatcttttccaaagctttctcctacttgtctcacaccatccccgacttc
acagacaactgtctgatcaacatcatgaaatgtggagaagacttctatgcaaccacggag
accaactacatcaggaaaatcgacccccagaccctagagaccttggagaaggttgattac
cggaagtatgtggcggtaaacctggctacctcgcaccctcattatgacgaggctgggaat
gtccttaacatgggcacatccgtcgtggacaaagggaggacaaaatacgtgatatttaag
atccctgccacagtgccagacagcaagaagaaagggaagagtcccgtgaagcacgcggaa
gttttctgctccatttcctcccgctcgttgctctctcccagctactaccacagctttggt
gtcacggagaactatgtggtgtttctggagcagccttttaagttggatatcctcaagatg
gccaccgcatacatgaggggagtgagctgggcttcctgtatgtcattcgacagggaggac
aagacatacattcatatcatcgaccagaggaccaggaagcctgtgcctaccaagttctac
acagatcccatggtggtcttccatcatgtcaatgcctacgaggaggacggctgtgtgctg
tttgatgtgatcgcctatgaggacagcagcctctatcagctcttctacctggccaacctg
aacaaggacttcgaggagaagtccaggctgacctcagtgcctaccctcaggaggtttgct
gtgcccctccatgtggacaaggatgcagaagtgggctcaaatttagtcaaggtgtcatct
acaactgcaacagccctgaaggagaaagacggccatgtctattgccagcccgaggtcctc
tacgaaggcctagagctccctcggataaattatgcttacaacgggaagccatatcgctac
atctttgcagctgaagtacagtggagtccagtcccaaccaagatactgaaatatgacatt
ctcacaaagtcctccttaaagtggtctgaggagagctgctggccagcagagcctctgttt
gttcccacgccaggtgcgaaggatgaagatgatgtcccttgcaggccaagcagagactgt
ggagtccaagggccccatcgtaaatcacattgtcagctgagcatagcatgtgtgcctgag
atctcagcatttgggaggcagacagaagacaatcaggggtctacagtcattctcagatat
acagagaatttgaactactaa

DBGET integrated database retrieval system