KEGG   Mus musculus (mouse): 63857Help
Entry
63857             CDS       T01002                                 

Gene name
Bco1, Bcdo, Bcdo1, Bcmo1, CMO1, Cmoi, beta-CD, betaCMOOX
Definition
(RefSeq) beta-carotene oxygenase 1 (EC:1.13.11.63)
  KO
K00515  
beta-carotene 15,15'-dioxygenase [EC:1.13.11.63]
Organism
mmu  Mus musculus (mouse)
Pathway
Retinol metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    63857 (Bco1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.63  beta-carotene 15,15'-dioxygenase
     63857 (Bco1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
8; 8 E1
AA seq 566 aa AA seqDB search
MEIIFGQNKKEQLEPVQAKVTGSIPAWLQGTLLRNGPGMHTVGESKYNHWFDGLALLHSF
SIRDGEVFYRSKYLQSDTYIANIEANRIVVSEFGTMAYPDPCKNIFSKAFSYLSHTIPDF
TDNCLINIMKCGEDFYATTETNYIRKIDPQTLETLEKVDYRKYVAVNLATSHPHYDEAGN
VLNMGTSVVDKGRTKYVIFKIPATVPDSKKKGKSPVKHAEVFCSISSRSLLSPSYYHSFG
VTENYVVFLEQPFKLDILKMATAYMRGVSWASCMSFDREDKTYIHIIDQRTRKPVPTKFY
TDPMVVFHHVNAYEEDGCVLFDVIAYEDSSLYQLFYLANLNKDFEEKSRLTSVPTLRRFA
VPLHVDKDAEVGSNLVKVSSTTATALKEKDGHVYCQPEVLYEGLELPRINYAYNGKPYRY
IFAAEVQWSPVPTKILKYDILTKSSLKWSEESCWPAEPLFVPTPGAKDEDDGVILSAIVS
TDPQKLPFLLILDAKSFTELARASVDADMHLDLHGLFIPDADWNAVKQTPAETQEVENSD
HPTDPTAPELSHSENDFTAGHGGSSL
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atggagataatatttggccagaataagaaagaacagctggagccagttcaggccaaagtg
acaggcagcattccagcatggctgcaggggaccctgctccgaaacgggcccgggatgcac
acagtgggagagagcaagtacaaccattggtttgatggcctggcccttctccacagtttc
tccatcagagatggggaggtcttctacaggagcaaatacctgcagagtgacacctacatc
gccaacattgaggccaacagaatcgtggtgtctgagttcggaaccatggcctacccggac
ccctgcaaaaacatcttttccaaagctttctcctacttgtctcacaccatccccgacttc
acagacaactgtctgatcaacatcatgaaatgtggagaagacttctatgcaaccacggag
accaactacatcaggaaaatcgacccccagaccctagagaccttggagaaggttgattac
cggaagtatgtggcggtaaacctggctacctcgcaccctcattatgacgaggctgggaat
gtccttaacatgggcacatccgtcgtggacaaagggaggacaaaatacgtgatatttaag
atccctgccacagtgccagacagcaagaagaaagggaagagtcccgtgaagcacgcggaa
gttttctgctccatttcctcccgctcgttgctctctcccagctactaccacagctttggt
gtcacggagaactatgtggtgtttctggagcagccttttaagttggatatcctcaagatg
gccaccgcatacatgaggggagtgagctgggcttcctgtatgtcattcgacagggaggac
aagacatacattcatatcatcgaccagaggaccaggaagcctgtgcctaccaagttctac
acagatcccatggtggtcttccatcatgtcaatgcctacgaggaggacggctgtgtgctg
tttgatgtgatcgcctatgaggacagcagcctctatcagctcttctacctggccaacctg
aacaaggacttcgaggagaagtccaggctgacctcagtgcctaccctcaggaggtttgct
gtgcccctccatgtggacaaggatgcagaagtgggctcaaatttagtcaaggtgtcatct
acaactgcaacagccctgaaggagaaagacggccatgtctattgccagcccgaggtcctc
tacgaaggcctagagctccctcggataaattatgcttacaacgggaagccatatcgctac
atctttgcagctgaagtacagtggagtccagtcccaaccaagatactgaaatatgacatt
ctcacaaagtcctccttaaagtggtctgaggagagctgctggccagcagagcctctgttt
gttcccacgccaggtgcgaaggatgaagatgatggagtcattttatcagccatcgtctct
acggatccccaaaagctgccttttttactcattctggatgccaaaagttttacggaactg
gctcgcgcctctgttgatgcggacatgcacctggaccttcatggtttatttatcccagat
gcagactggaatgcagtgaagcagactccagctgaaacgcaagaggttgaaaactcagat
catcccacagatccgacagcaccagaactgagccacagtgaaaatgacttcacagcgggt
catggtggctcaagtctttaa

DBGET integrated database retrieval system