KEGG   Mus musculus (mouse): 63873Help
Entry
63873             CDS       T01002                                 

Gene name
Trpv4, 0610033B08Rik, OTRPC4, Trp12, VR-OAC, VRL-2, VROAC
Definition
(RefSeq) transient receptor potential cation channel, subfamily V, member 4
  KO
K04973  
transient receptor potential cation channel subfamily V member 4
Organism
mmu  Mus musculus (mouse)
Pathway
Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    63873 (Trpv4)
Ion channels [BR:mmu04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPV (Vanilloid)
   63873 (Trpv4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5; 5 F
AA seq 871 aa AA seqDB search
MADPGDGPRAAPGEVAEPPGDESGTSGGEAFPLSSLANLFEGEEGSSSLSPVDASRPAGP
GDGRPNLRMKFQGAFRKGVPNPIDLLESTLYESSVVPGPKKAPMDSLFDYGTYRHHPSDN
KRWRRKVVEKQPQSPKAPAPQPPPILKVFNRPILFDIVSRGSTADLDGLLSFLLTHKKRL
TDEEFREPSTGKTCLPKALLNLSNGRNDTIPVLLDIAERTGNMREFINSPFRDIYYRGQT
SLHIAIERRCKHYVELLVAQGADVHAQARGRFFQPKDEGGYFYFGELPLSLAACTNQPHI
VNYLTENPHKKADMRRQDSRGNTVLHALVAIADNTRENTKFVTKMYDLLLLKCSRLFPDS
NLETVLNNDGLSPLMMAAKTGKIGVFQHIIRREVTDEDTRHLSRKFKDWAYGPVYSSLYD
LSSLDTCGEEVSVLEILVYNSKIENRHEMLAVEPINELLRDKWRKFGAVSFYINVVSYLC
AMVIFTLTAYYQPLEGTPPYPYRTTVDYLRLAGEVITLFTGVLFFFTSIKDLFTKKCPGV
NSLFVDGSFQLLYFIYSVLVVVSAALYLAGIEAYLAVMVFALVLGWMNALYFTRGLKLTG
TYSIMIQKILFKDLFRFLLVYLLFMIGYASALVTLLNPCTNMKVCDEDQSNCTVPTYPAC
RDSETFSAFLLDLFKLTIGMGDLEMLSSAKYPVVFILLLVTYIILTFVLLLNMLIALMGE
TVGQVSKESKHIWKLQWATTILDIERSFPVFLRKAFRSGEMVTVGKSSDGTPDRRWCFRV
DEVNWSHWNQNLGIINEDPGKSEIYQYYGFSHTVGRLRRDRWSSVVPRVVELNKNSSADE
VVVPLDNLGNPNCDGHQQGYAPKWRTDDAPL
NT seq 2616 nt NT seq  +upstreamnt  +downstreamnt
atggcagatcctggtgatggtccccgtgcagcgcctggggaggtggctgagccccctgga
gatgagagtggtacctctggtggggaggccttccccctctcttccctggccaatctgttt
gagggggaggaaggctcctcttctctttccccggtggatgctagccgccctgctggccct
ggcgatggacgtccaaacctgcgtatgaagttccagggcgctttccgcaagggggttccc
aaccccattgacctgttggagtccaccctgtacgagtcctcagtagtgcctgggcccaag
aaagcgcccatggattccttgttcgactacggcacttaccgtcaccaccccagtgacaac
aagagatggaggagaaaggtcgtggagaagcagccacagagccccaaagctcctgcaccc
cagccaccccccatcctcaaagtcttcaatcggcccatcctctttgacattgtgtcccgg
ggctccactgcggacctagatggactgctctccttcttgttgacccacaagaagcgcctg
actgatgaggagttccgggagccgtccacggggaagacctgcctgcccaaggcgctgctg
aacctaagcaacgggcgcaacgacaccatcccggtgttgctggacattgcggagcgcacc
ggcaacatgcgtgaattcatcaactcgcccttcagagacatctactaccgaggccagaca
tccctgcacattgccatcgaacggcgctgcaagcactacgtggagctgctggtggcccag
ggagccgacgtgcacgcccaggcccgcggccgcttcttccagcccaaggatgagggaggc
tacttctactttggggagctgcccttgtccctggcagcctgcaccaaccagccgcacatc
gtcaactacctgacagagaaccctcacaagaaagctgacatgaggcgacaggactcgagg
gggaacacggtgctgcacgcgctggtggccatcgccgacaacacccgagagaacaccaag
tttgtcaccaagatgtacgacctgctgcttctcaagtgttcacgcctcttccccgacagc
aacctggagacagttctcaacaatgatggcctttcgcctctcatgatggctgccaagaca
ggcaagatcggggtctttcagcacatcatccgacgtgaggtgacagatgaggacacccgg
catctgtctcgcaagttcaaggactgggcctatgggcctgtgtattcttctctctacgac
ctctcctccctggacacatgcggggaggaggtgtccgtgctggagatcctggtgtacaac
agcaagatcgagaaccgccatgagatgctggctgtagagcccattaacgaactgttgaga
gacaagtggcgtaagtttggggctgtgtccttctacatcaacgtggtctcctatctgtgt
gccatggtcatcttcaccctcaccgcctactatcagccactggagggcacgccaccctac
ccttaccggaccacagtggactacctgaggctggctggcgaggtcatcacgctcttcaca
ggagtcctgttcttctttaccagtatcaaagacttgttcacgaagaaatgccctggagtg
aattctctcttcgtcgatggctccttccagttactctacttcatctactctgtgctggtg
gttgtctctgcggcgctctacctggctgggatcgaggcctacctggctgtgatggtcttt
gccctggtcctgggctggatgaatgcgctgtacttcacgcgcgggttgaagctgacgggg
acctacagcatcatgattcagaagatcctcttcaaagacctcttccgcttcctgcttgtg
tacctgctcttcatgatcggctatgcctcagccctggtcaccctcctgaatccgtgcacc
aacatgaaggtctgtgacgaggaccagagcaactgcacggtgcccacgtatcctgcgtgc
cgcgacagcgagaccttcagcgccttcctcctggacctcttcaagctcaccatcggcatg
ggagacctggagatgctgagcagcgccaagtaccccgtggtcttcatcctcctgctggtc
acctacatcatcctcaccttcgtgctcctgttgaacatgcttatcgccctcatgggtgag
accgtgggccaggtgtccaaggagagcaagcacatctggaagttgcagtgggccaccacc
atcctggacatcgagcgttccttccctgtgttcctgaggaaggccttccgctccggagag
atggtgactgtgggcaagagctcagatggcactccggaccgcaggtggtgcttcagggtg
gacgaggtgaactggtctcactggaaccagaacttgggcatcattaacgaggaccctggc
aagagtgaaatctaccagtactatggcttctcccacaccgtggggcgccttcgtagggat
cgttggtcctcggtggtgccccgcgtagtggagctgaacaagaactcaagcgcagatgaa
gtggtggtacccctggataacctagggaaccccaactgtgacggccaccagcagggctac
gctcccaagtggaggacggacgatgccccactgtag

DBGET integrated database retrieval system