KEGG   Mus musculus (mouse): 63985Help
Entry
63985             CDS       T01002                                 

Gene name
Gmfb, 3110001H22Rik, 3110001O16Rik, AI851627, C79176, D14Ertd630e
Definition
(RefSeq) glia maturation factor, beta
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14 C1; 14 24.32 cM
AA seq 142 aa AA seqDB search
MSESLVVCDVAEDLVEKLRKFRFRKETHNAAIIMKIDKDERLVVLDEELEGVSPDELKDE
LPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKV
FEIRNTEDLTEEWLREKLGFFH
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagtctttggtggtttgtgatgttgctgaagatttagtggaaaagctgagaaag
tttcgttttcgaaaagaaacccacaatgctgctattataatgaagattgacaaggatgaa
cgcctggtggtgctggatgaggagctcgagggtgtctctccagatgaacttaaagacgaa
ctacccgagcggcagcctcgcttcattgtgtatagttataaataccaacatgatgatggc
agagtctcgtacccgctctgctttattttctccagtcctgtcgggtgtaagcctgagcag
cagatgatgtacgctgggagtaagaacaagctagtccagactgccgagctaaccaaggta
tttgaaataagaaacactgaagatctaactgaagaatggttacgtgagaaacttggattt
ttccactaa

DBGET integrated database retrieval system