KEGG   Mus musculus (mouse): 64051Help
Entry
64051             CDS       T01002                                 

Gene name
Sv2a, AI746429, mKIAA0736
Definition
(RefSeq) synaptic vesicle glycoprotein 2 a
  KO
K06258  
MFS transporter, VNT family, synaptic vesicle glycoprotein 2
Organism
mmu  Mus musculus (mouse)
Pathway
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    64051 (Sv2a)
Transporters [BR:mmu02000]
 Major Facilitator Superfamily (MFS)
  Protein transporters
   Vesicular neurotransmitter transporter (VNT) [TC:2.A.1.22]
    64051 (Sv2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
3; 3 F2
AA seq 742 aa AA seqDB search
MEEGFRDRAAFIRGAKDIAKEVKKHAAKKVVKGLDRVQDEYSRRSYSRFEEEDDDDDFPA
PADGYYRGEGAQDEEEGGASSDATEGHDEDDEIYEGEYQGIPRAESGGKGERMADGAPLA
GVRGGLSDGEGPPGGRGEAQRRKDREELAQQYETILRECGHGRFQWTLYFVLGLALMADG
VEVFVVGFVLPSAEKDMCLSDSNKGMLGLIVYLGMMVGAFLWGGLADRLGRRQCLLISLS
VNSVFAFFSSFVQGYGTFLFCRLLSGVGIGGSIPIVFSYFSEFLAQEKRGEHLSWLCMFW
MIGGVYAAAMAWAIIPHYGWSFQMGSAYQFHSWRVFVLVCAFPSVFAIGALTTQPESPRF
FLENGKHDEAWMVLKQVHDTNMRAKGHPERVFSVTHIKTIHQEDELIEIQSDTGTWYQRW
GVRALSLGGQVWGNFLSCFSPEYRRITLMMMGVWFTMSFSYYGLTVWFPDMIRHLQAVDY
AARTKVFPGERVEHVTFNFTLENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVT
SSNTFFRNCTFINTVFYNTDLFEYKFVNSRLVNSTFLHNKEGCPLDVTGTGEGAYMVYFV
SFLGTLAVLPGNIVSALLMDKIGRLRMLAGSSVLSCVSCFFLSFGNSESAMIALLCLFGG
VSIASWNALDVLTVELYPSDKRTTAFGFLNALCKLAAVLGISIFTSFVGITKAAPILFAS
AALALGSSLALKLPETRGQVLQ
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaggctttcgagaccgagcagcgttcatccgtggggccaaagacattgccaag
gaagtgaagaagcatgcggccaagaaggtggtgaagggccttgacagagtccaggatgag
tattcccgaaggtcctactcccgctttgaggaggaggacgacgacgatgacttccctgcc
cctgcggacggctattaccgcggagaaggggcccaggatgaggaggaaggtggcgcttct
agtgatgccaccgagggccacgatgaagatgatgagatctatgagggagaatatcagggc
atcccccgggcagagtctgggggcaaaggcgaacgcatggcagatggggcacccctggct
ggagtgagagggggcttgagtgatggggagggtccccctgggggtcggggggaggcgcag
cggcgtaaagatcgggaagaattggctcagcagtatgaaaccatcctccgggagtgtggc
catggccgcttccagtggacactctacttcgtgctgggtctggcgctgatggcagatggt
gtagaggtctttgtggtgggctttgtgctgcccagtgctgagaaagacatgtgcctgtcg
gactccaacaaaggcatgctaggcctcattgtgtacctgggcatgatggtgggggccttc
ctctggggaggcctggctgatcggctgggtcggagacagtgtctgctcatctcactctca
gtcaacagcgtcttcgccttcttctcgtccttcgtccagggttatggaacctttctcttc
tgccgcctcctttccggggtcgggattggcggttccatccccatagtcttctcctatttt
tcggagtttctggcgcaggagaaacgtggggagcatttgagctggctctgtatgttctgg
atgatcggtggagtgtatgcagctgcaatggcctgggccatcatccctcactatgggtgg
agtttccagatgggctctgcttaccagttccacagctggagggtgtttgtcctcgtgtgt
gcctttccctctgtgtttgccatcggggctctgactacgcagccagagagtccccgcttc
ttcctagagaatgggaagcatgacgaagcctggatggtactgaagcaggttcacgacacc
aacatgcgagccaagggccaccctgagcgcgtcttctcagtgacccacattaaaacgatt
catcaagaggatgaattgattgagatccagtctgacacaggaacctggtaccagcgctgg
ggagtacgggctttgagccttgggggtcaggtttgggggaatttcctctcctgcttcagt
ccagagtatcggcgcatcacgctgatgatgatgggtgtgtggttcaccatgtctttcagc
tactatggtttgactgtctggtttcccgacatgatccgccatctccaggctgtggactat
gcagcccgaaccaaagtgttcccaggggagcgcgtggagcatgtgacgtttaacttcaca
ctggagaatcagatccaccgagggggacagtacttcaatgacaagttcatcgggctgcgt
ctgaagtcagtgtcctttgaggattccctgtttgaggagtgttactttgaagatgttaca
tccagcaacacattcttccgcaactgcacgttcatcaacactgtgttctataacactgac
ctatttgagtacaagttcgtgaacagccggctggtgaacagcacgttcctgcacaataag
gaaggctgcccgctagacgtgacggggacaggcgaaggtgcctacatggtgtactttgtc
agcttcttggggacactggctgtgcttcctggaaacattgtgtctgctctgctcatggac
aagattggcaggctcagaatgcttgctggttccagtgtgttgtcctgtgtgtcctgcttc
ttcctgtcttttgggaacagcgagtcagccatgatcgctctgctctgcctttttggggga
gttagcatcgcatcctggaacgcgctggacgtgctgaccgttgagctctacccttccgac
aagaggactactgcctttggcttcctgaatgccctgtgtaagctggcagctgtgctgggg
atcagcatcttcacatcctttgtgggcatcaccaaggctgctcccattctctttgcctcg
gctgctcttgcccttggtagctctctggctctgaagctgcctgagacccggggacaggtg
ctgcagtga

DBGET integrated database retrieval system