KEGG   Mus musculus (mouse): 64177Help
Entry
64177             CDS       T01002                                 

Gene name
Trpv6, CAT, CaT1, Cac, Ecac2, Otrpc3
Definition
(RefSeq) transient receptor potential cation channel, subfamily V, member 6
  KO
K04975  
transient receptor potential cation channel subfamily V member 6
Organism
mmu  Mus musculus (mouse)
Pathway
Salivary secretion
Mineral absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Digestive system
   04970 Salivary secretion
    64177 (Trpv6)
   04978 Mineral absorption
    64177 (Trpv6)
Ion channels [BR:mmu04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPV (Vanilloid)
   64177 (Trpv6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6; 6 B2
AA seq 767 aa AA seqDB search
MGPLQREDRPALGGANVAPGSSPVGVWHQPQPPKEPAFHPMGWSLPKEKGLILCLWNKFC
RWFHRQESWAQSRDEQNLLQQKRIWESPLLLAAKENDVQALSKLLKFEGCEVHQRGAMGE
TALHIAALYDNLEAAMVLMEAAPELVFEPMTSELYEGQTALHIAVINQNVNLVRALLARG
ASVSARATGSVFHYRPHNLIYYGEHPLSFAACVGSEEIVRLLIEHGADIRAQDSLGNTVL
HILILQPNKTFACQMYNLLLSYDGGDHLKSLELVPNNQGLTPFKLAGVEGNIVMFQHLMQ
KRKHIQWTYGPLTSTLYDLTEIDSSGDDQSLLELIVTTKKREARQILDQTPVKELVSLKW
KRYGRPYFCVLGAIYVLYIICFTMCCVYRPLKPRITNRTNPRDNTLMQQKLLQEAYVTPK
DDLRLVGELVSIVGAVIILLVEIPDIFRLGVTRFFGQTILGGPFHVIIITYAFMVLVTMV
MRLTNVDGEVVPMSFALVLGWCNVMYFARGFQMLGPFTIMIQKMIFGDLMRFCWLMAVVI
LGFASAFYIIFQTEDPDELGHFYDYPMALFSTFELFLTIIDGPANYDVDLPFMYSVTYAA
FAIIATLLMLNLLIAMMGDTHWRVAHERDELWRAQVVATTVMLERKLPRCLWPRSGICGR
EYGLGDRWFLRVEDRQDLNRQRIRRYAQAFQQQDGLYSEDLEKDSGEKLETARPFGAYLS
FPTPSVSRSTSRSSTNWERLRQGALRKDLRGIINRGLEDGEGWEYQI
NT seq 2304 nt NT seq  +upstreamnt  +downstreamnt
acgggacctctacagagagaggacaggccggctcttgggggtgccaatgtggccccaggg
tcgagcccagttggggtctggcatcagcctcagccccccaaggaaccagccttccacccc
atggggtggtccctgcccaaggagaaggggttaatactctgcctatggaacaagttctgc
agatggttccacagacaagagtcctgggctcagagccgagacgagcagaacctgctgcag
cagaagaggatctgggaatcacctcttcttctagctgccaaagaaaacgatgtccaggct
ctgagcaagctgctcaagtttgaaggatgtgaggtgcaccagagaggagccatgggggaa
actgcacttcacatagcagccctctatgataacctggaggctgcaatggtgctaatggag
gctgccccagaactagtctttgagcccatgacttcggagctatatgaaggtcagactgca
ctacacattgcagtaataaaccagaatgtaaacttggtccgtgctctgcttgcccgaggg
gccagtgtctctgccagagctacaggctctgtcttccactacaggcctcacaacctcatt
tactatggagagcaccctttgtcctttgctgcctgtgtgggtagtgaggagattgttaga
ctgctcattgagcatggagctgacatccgtgcccaggactctctgggaaatacagtacta
cacatactcatcctgcagcccaacaaaacctttgcctgccagatgtacaacttgctactg
tcctatgatgggggagaccacctgaagtccctggaacttgtgccaaataaccagggactc
acccccttcaagttggctggggtggaaggcaacattgtgatgttccaacacctgatgcag
aagcggaaacacatccagtggacatatgggccattgacctccacactgtatgacctcact
gagattgactcctcaggagatgatcaatccctactggaacttattgttactaccaagaaa
cgggaggctcgccagatcctggaccagacacctgtaaaggaactggtgagcctcaagtgg
aagaggtatgggcggccctacttctgcgtgctgggtgccatctatgtgctgtacatcatc
tgctttaccatgtgctgtgtctaccgcccgctcaagcccaggatcactaaccgcaccaac
ccccgggacaacactctgatgcaacagaagctccttcaggaggcctatgtgacccctaag
gatgacctccggttggtgggggaactcgtgagcatcgttggggctgtgatcatcctgctg
gtggagattccagacatcttcaggttgggggtcactcgattctttggacagaccattctc
ggggggccattccatgtcatcattatcacttatgccttcatggtgctggtgaccatggtg
atgcgactcaccaatgtagatggagaagtggtgcccatgtcctttgctctggtgttgggc
tggtgcaatgtcatgtactttgccagaggattccagatgctgggtcccttcaccatcatg
attcagaagatgatttttggtgacttgatgcgattctgctggctgatggctgtggtaatt
ctgggatttgcttcagccttctatatcattttccagacagaggatcccgatgagctgggt
catttctatgactaccccatggcactgttcagcacctttgaactcttcctcaccatcatc
gatggccctgccaactatgacgtggatctgcccttcatgtacagcgttacctacgctgcc
tttgccatcatcgccacactgctcatgcttaacctcctcattgccatgatgggtgacact
cactggagagttgcccatgagcgagatgagctctggagagcacaggttgtggccaccact
gtgatgttagagcggaagctacctcgttgcctgtggcctcgctctgggatatgtgggcga
gagtatggtcttggcgaccgctggttcttgagggtggaagacaggcaagatctcaacaga
caacgcatccgccgctatgcacaggccttccagcaacaagatggcctctactctgaggac
ttggaaaaagattcaggagaaaaactggagacagcacgtccctttggtgcctatctgtcc
tttcctacaccctcagtatctcgaagtacctcccgaagcagcaccaattgggaaaggctt
cgacaaggggccctgaggaaggacctgcgggggataatcaaccggggcctagaagatggg
gagggctgggagtaccagatctga

DBGET integrated database retrieval system