KEGG   Mus musculus (mouse): 64214Help
Entry
64214             CDS       T01002                                 

Gene name
Rgs18
Definition
(RefSeq) regulator of G-protein signaling 18
  KO
K16449  
regulator of G-protein signaling
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1 F; 1 62.99 cM
AA seq 235 aa AA seqDB search
MDMSLVFFSQLNMCESKEKTFFKLMHGSGKEETSIEAKIRAKEKRNRLSLLLQRPDFHGE
TQASRSALLAKETRVSPEEAVKWAESFDKLLSHRDGVDAFTRFLKTEFSEENIEFWVACE
DFKKCKEPQQIILKAKAIYEKFIQNDAPKEVNIDFHTKEVIAKSIAQPTLHSFDTAQSRV
YQLMEHDSYKRFLKSETYLHLIEGRPQRPTNLRRRSRSFTYNDFQDVKSDVAIWL
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggatatgtcactggttttcttctctcaattaaatatgtgtgaatcaaaagagaaaact
tttttcaaactaatgcatgggtcagggaaagaagaaacaagcatcgaggccaaaatcaga
gcgaaagaaaaaaggaatagactaagtcttctcctacagaggcctgacttccatggagag
actcaagccagtagatctgccctcttggccaaagaaacaagagtctctcctgaagaagca
gtgaaatgggctgaatcatttgacaaattgctctctcatagagatggagtggatgctttt
accagatttcttaaaactgaattcagtgaggagaacattgaattttgggtcgcctgtgaa
gacttcaagaaatgcaaggaacctcaacaaatcatcctaaaagcaaaggcaatctatgag
aaattcattcagaatgatgcccccaaagaggttaacattgattttcatactaaagaagta
attgctaagagcatcgcccagcccactctccacagttttgatacggcacaaagcagagtg
taccagctcatggaacatgacagttataaacgctttttgaaatctgagacctacttacat
ttgatagaaggaagacctcagagaccaacaaaccttaggagacgatcacgatcatttact
tacaatgatttccaagatgtaaagtcagatgttgccatttggttatga

DBGET integrated database retrieval system