KEGG   Mus musculus (mouse): 64293Help
Entry
64293             CDS       T01002                                 

Gene name
Stk32b, 2510009F08Rik, STKG6, Stk32, YANK2
Definition
(RefSeq) serine/threonine kinase 32B (EC:2.7.11.1)
  KO
K08793  
serine/threonine kinase 32 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     64293 (Stk32b)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: AGC group
  YANK family
   64293 (Stk32b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5; 5 B2
AA seq 414 aa AA seqDB search
MGGNHSHKPPVFDENEEVNFDHFQILRAIGKGSFGKVCIVQKRDTKKMYAMKYMNKQKCV
ERDEVRNVFRELQIMQGLEHPFLVNLWYSFQDEEDMFMVVDLLLGGDLRYHLQQNVHFTE
GTVKLYICELALALEYLQRYHIIHRDIKPDNILLDEHGHVHITDFNIATVLKGSEKASSM
AGTKPYMAPEVFQVYVDGGPGYSYPVDWWSLGVTAYELLRGWRPYEIHSATPIDEILNMF
KVERVHYSSTWCEGMVSLLKKLLTKDPESRLSSLRDIQSMTYLADMNWDAVFEKALMPGF
VPNKGRLNCDPTFELEEMILESKPLHKKKKRLAKHRSRDSTKDSCPLNGHLQQCLETVRK
EFIIFNREKLRRQQGHNGQLSDLDGRIGSQTSSKLQDGRNNNILTHTCPRGCSS
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgggcgggaaccactcccacaagcccccagtgtttgatgagaacgaagaagtcaacttt
gaccacttccagatcctgcgggccattgggaaaggaagttttggaaaggtatgcatcgtg
cagaagcgagacacaaagaagatgtatgccatgaagtacatgaacaagcaaaagtgtgtg
gagagggatgaggtgcggaacgtgttccgggagctgcagatcatgcagggattagagcac
cccttcctggtgaacctatggtactccttccaggatgaggaagacatgttcatggtggtg
gacctgctgctgggtggggacctgcgctaccacctacagcagaatgtgcacttcacagag
gggaccgtgaagctgtacatctgtgagctggccctggctctggagtacctgcagaggtac
cacatcatccacagagacatcaagccagacaacatcctactggatgagcatgggcacgtg
cacataacggacttcaacatcgccacggtcctgaaaggaagtgagaaggcttcctccatg
gctggcacgaagccctacatggcccctgaagtcttccaggtgtatgtggatggaggccct
gggtactcataccccgtggactggtggtcactgggtgtcacagcctatgagctgctccga
ggctggaggccatatgagatccactcagccacacccattgatgagattctcaacatgttc
aaggtggagcgtgtccactactcctccacgtggtgtgaggggatggtgtccctgctgaag
aagctgctgaccaaggaccctgagagccgcttgtcaagtcttcgtgacatccagagcatg
acctacctggctgacatgaactgggatgcagtattcgagaaggccctgatgcctggcttt
gtgcccaataaagggagactgaactgtgaccccacatttgaacttgaagaaatgattcta
gaatccaagccacttcacaaaaagaagaagaggttggccaagcataggtccagagacagc
acaaaggacagctgtcccctgaatggacacctgcagcagtgtttggagacagtgcggaaa
gagttcatcatattcaaccgagagaaactcaggaggcagcagggacataatggccaactc
tcagacctggatggccgaataggaagccagacctcaagcaagctgcaggatggtcgaaac
aataacatcctgacccatacatgcccccgaggctgcagcagctaa

DBGET integrated database retrieval system