KEGG   Mus musculus (mouse): 65114Help
Entry
65114             CDS       T01002                                 

Gene name
Vps35, AI647796, Mem3
Definition
(RefSeq) VPS35 retromer complex component
  KO
K18468  
vacuolar protein sorting-associated protein 35
Organism
mmu  Mus musculus (mouse)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    65114 (Vps35)
Membrane trafficking [BR:mmu04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Retromer subcomplex
    65114 (Vps35)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
8 C3; 8 41.61 cM
AA seq 796 aa AA seqDB search
MPTTQQSPQDEQEKLLDEAIQAVKVQSFQMKRCLDKNKLMDALKHASNMLGELRTSMLSP
KSYYELYMAISDELHYLEVYLTDEFAKGRKVADLYELVQYAGNIIPRLYLLITVGVVYVK
SFPQSRKDILKDLVEMCRGVQHPLRGLFLRNYLLQCTRNILPDEGEPTDEETTGDISDSM
DFVLLNFAEMNKLWVRMQHQGHSRDREKRERERQELRILVGTNLVRLSQLEGVNVERYKQ
IVLTGILEQVVNCRDALAQEYLMECIIQVFPDEFHLQTLNPFLRACAELHQNVNVKNIII
ALIDRLALFAHREDGPGIPAEIKLFDIFSQQVATVIQSRQDMPSEDVVSLQVSLINLAMK
CYPDRVDYVDKVLETTVEIFNKLNLEHIATSSAVSKELTRLLKIPVDTYNNILTVLKLKH
FHPLFEYFDYESRKSMSCYVLSNVLDYNTEIVSQDQVDSIMNLVSTLIQDQPDQPVEDPD
PEDFADEQSLVGRFIHLLRSDDPDQQYLILNTARKHFGAGGNQRIRFTLPPLVFAAYQLA
FRYKENSQMDDKWEKKCQKIFSFAHQTISALIKAELAELPLRLFLQGALAAGEIGFENHE
TVAYEFMSQAFSLYEDEISDSKAQLAAITLIIGTFERMKCFSEENHEPLRTQCALAASKL
LKKPDQGRAVSTCAHLFWSGRNTDKNGEELHGGKRVMECLKKALKIANQCMDPSLQVQLF
IEILNRYIYFYEKENDAVTIQVLNQLIQKIREDLPNLESSEETEQINKHFHNTLEHLRSR
RESPESEGPIYEGLIL
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgcctacaacacagcagtcaccccaggatgagcaggaaaaacttttggatgaagccatc
caggctgtgaaggttcagtcattccagatgaaaagatgcctggacaaaaacaagctgatg
gatgctctgaagcatgcctccaatatgcttggagagctccggacctctatgctgtcacca
aagagttactatgaactttatatggctatttctgatgaactgcactacttggaggtctac
ctgactgatgaatttgctaaaggaagaaaggtggcagatctctatgaacttgtacagtac
gcgggaaacattattccaaggctttatctcttgatcacagttggagttgtatatgtcaag
tcatttcctcaatccaggaaagatattttgaaagatttggtagaaatgtgccgtggtgtg
cagcatccgctaaggggtttgtttcttcgaaattaccttcttcagtgtactaggaacatt
ttacctgatgaaggagagccaacagatgaagaaacaactggtgatatcagtgattccatg
gattttgtactactcaactttgcagaaatgaataagctctgggtgcggatgcagcatcaa
ggacatagtcgagatagagaaaaaagagaacgagagagacaagaactgagaattttagtg
ggaacaaatttggtgcgccttagtcagttggaaggtgtaaatgtggaacgttacaaacag
attgttctaacaggcattctggagcaggttgtgaattgtagggatgctctggctcaggag
tatctcatggagtgcatcattcaggtttttcctgatgagtttcatcttcagactttgaat
ccttttcttagagcttgtgctgaattacaccaaaatgtaaatgtgaaaaacataatcatt
gctttaattgacagattagctttatttgctcatcgtgaagatggacccggaattccagct
gagattaaactttttgacatattttcacaacaggtggctacagtcatacagtccagacaa
gacatgccatcagaggatgttgtatctttacaagtctctctcattaatcttgctatgaaa
tgttaccctgatcgtgtggactacgtcgataaagttctagaaacaacagtggagatattc
aataagcttaaccttgaacatattgctaccagtagtgcagtttcaaaggagcttaccaga
cttttgaagatacctgttgatacttacaacaatatcttaacagtattaaagttaaagcat
ttccacccactttttgagtactttgactacgagtccagaaagagcatgagctgttatgtg
cttagtaatgttctggattataacacagaaatcgtctctcaggaccaggtagattccata
atgaatttggtgtccacattgattcaggatcagccagaccaacctgtagaagaccctgat
ccagaagacttcgctgatgaacagagccttgttggccgatttattcatctgctacgttct
gatgatcctgaccagcagtatttgattttgaatacggcacgaaaacattttggggctggt
ggaaatcagcggattcgcttcacactgccacctttggtatttgcagcttaccagttggct
tttcgatacaaagagaattcccaaatggatgacaagtgggaaaagaaatgccagaagata
ttttcatttgctcaccagactatcagtgctttgattaaagctgagctggctgaattacca
ctgagactttttcttcaaggagcattagctgctggagaaattggctttgaaaatcatgaa
acagtagcatatgaatttatgtcccaggcattttctctatatgaagatgaaatcagtgat
tctaaagcacagctggctgctatcaccttgatcatcggtacttttgagaggatgaaatgc
ttcagtgaagagaatcatgaacccttgagaactcagtgtgcacttgctgcatcaaaactt
ctgaaaaaaccagatcaaggccgagccgtgagcacatgtgcgcatctcttttggtctggc
cgaaacacagacaaaaatggggaagagcttcatggaggtaaaagggtcatggagtgccta
aagaaggcactaaaaatagcaaatcagtgcatggacccctctctacaagttcagctcttt
atagagattctgaacaggtacatctatttctatgaaaaagaaaatgatgcggtaaccatt
caagtcttgaaccaacttattcaaaagattcgagaagatctcccaaatcttgagtccagt
gaagaaacagaacaaataaacaagcattttcacaacacattggagcacttgcgctcaaga
cgggaatcaccagagtctgaggggccaatctatgaaggtctcatcctttaa

DBGET integrated database retrieval system