KEGG   Mus musculus (mouse): 65257Help
Entry
65257             CDS       T01002                                 

Gene name
Asb3, 2400011J03Rik, Asb-3
Definition
(RefSeq) ankyrin repeat and SOCS box-containing 3
  KO
K10325  ankyrin repeat and SOCS box protein 3
Organism
mmu  Mus musculus (mouse)
Brite
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     65257 (Asb3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_4 Ank Ank_3 Ank_5 SOCS_box
Motif
Other DBs
NCBI-GeneID: 65257
NCBI-ProteinID: NP_076395
MGI: 1929749
Ensembl: ENSMUSG00000020305
Vega: OTTMUSG00000005359
UniProt: Q9WV72
Position
11 A4; 11 18.19 cM
AA seq 525 aa AA seqDB search
MDFTEAYSDTCSTVGLAAREGNVKILRKLLKKGRSVDVADNRGWMPIHEAAYHNAVECLQ
MLIHTDSSENYIKAKTFEGFCALHLAVSQGHWKITQILLEAGADPNETTLEETTPLFLAV
ESGRIDVLKLLLQHGANVNGSHSMSGWNSLHQASFQGNAETIRLLLKQGADRECQDDFGI
TPLFVAAQYGKLESMSILISSGANVNCQALDKATPLFIAAQEGHTKCVELLLSSGADPDL
YCNEDNWQLPIHAAAQMGHTETLDLLIPRTNRACDTGPDKVSPVYSAVFGGREECLEMLL
QNGYSPDAQMCLVFGFSSPLCMAFQKDCDFSGIVNILLKYGAQLNELHLAYCLKYEKFSM
FCSFLKKGSLMVPWNHTSEFISYAVKAQTKYKAWLPHLLLAGFDPLILLCSSSWVDSASD
DILIFTLEFSNWKRLPSAVEKMLSVRANSSWALQQHLASVPSLTHLCRLEIRASLKAEHL
HSDIFIHQLPLPRSLQNYLLYEEVLRMNEILEPAANQDGETSKAT
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggattttacagaggcttactcagacacgtgttctacggttggacttgctgccagagaa
ggcaatgttaaaattctaaggaaattgctcaaaaaaggccgaagtgtggatgtcgctgat
aacaggggatggatgccgattcatgaagcagcttatcacaatgctgtagagtgtttgcag
atgctaattcatacagattcatctgaaaactacattaaggcaaagacgtttgagggcttc
tgtgcattgcatcttgctgtgagtcaaggacattggaaaatcacacagattcttttggaa
gctggagctgatcctaatgaaaccactttagaagaaactacaccattgtttttagctgtt
gaaagtggacggatagatgtattaaagctgttgcttcaacatggagcaaatgtcaatgga
tcccattctatgagtggatggaattccttgcaccaggcttctttccagggaaatgctgag
actataagattgcttcttaaacaaggagcagacagagaatgccaagatgactttggaatc
acacctctgtttgtggctgctcagtatgggaagctagagagcatgagcatacttatttca
tctggtgcaaatgtcaattgccaagccttggataaagctactcctttgtttattgctgca
caagagggtcatacaaaatgtgtggaacttttgctgtccagtggggcggatcctgacctt
tattgtaatgaagacaattggcaattacctattcatgctgctgcacaaatgggccataca
gagaccttggacttgttaataccacgtactaaccgggcttgtgacactggaccagacaaa
gtgagccctgtttattctgcagtgtttggaggacgggaagagtgcctggaaatgttactg
cagaatggctatagcccagatgcacaaatgtgcttggtatttggattcagttcccctctg
tgcatggctttccaaaaggactgtgatttttctggaattgtgaatattcttttgaagtat
ggagcccagttaaatgaacttcacttggcatactgcctcaagtatgagaagttttcaatg
ttttgctcttttttgaagaaaggttccctgatggtaccttggaatcatacatctgaattc
ataagttatgcagttaaagcacaaacaaaatacaaggcatggttgccacatctcctgctt
gctggatttgacccattgattctgctgtgcagcagctcttgggttgattcagccagtgat
gacatccttatctttactttggaattttctaattggaagagacttccttcagctgttgaa
aagatgctctctgttcgtgcaaactcctcttgggctcttcaacaacatttggcctctgtt
ccaagcctaacccatctttgtcgtttggaaattcgggccagtctaaaagcagagcacctt
cactctgacattttcatccatcagttgccacttcccagaagtctgcagaactatttgctc
tatgaagaggttttaagaatgaatgagattctagaaccagcagctaatcaggatggagaa
accagcaaggccacctga

DBGET integrated database retrieval system