KEGG   Mus musculus (mouse): 65962Help
Entry
65962             CDS       T01002                                 

Gene name
Slc9a3r2, 0610011L07Rik, 1200011K07Rik, 2010007A20Rik, E3karp, NHERF-2, Octs2, Sip-1, Sip1, Sryip1, Tka-1
Definition
solute carrier family 9 (sodium/hydrogen exchanger), member 3 regulator 2
Orthology
K13358  
Na(+)/H(+) exchange regulatory cofactor NHE-RF2
Organism
mmu  Mus musculus (mouse)
Pathway
Aldosterone-regulated sodium reabsorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    65962 (Slc9a3r2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
17 A3.3; 17
AA seq 337 aa AA seqDB search
MAALESLRPRLCRLVRGEQGYGFHLHGEKGRRGQFIRRVEPGSPAEAAALRAGDRLVEVN
GVNVEGETHHQVVQRIKAVEGQTQLLVVDKETDEELCRRQLTCTEEMAHRGLPPAHNPWE
PKPDWACSGSLGSDTGQKDVNGPPRELRPRLCHLRRGPQGYGFNLHSDKSRPGQYIRSVD
PGSPASHSGLRAQDRLIEVNGQNVEGLRHAEVVARIKAQEDEARLLVVDPETDEHFKRLR
VIPTEEHVEGPLPSPVTNGTSPAQLNGGSVCSSRSDLPGSEKDNEDGSTWKRDPFQESGL
HLSPTAAEAKEKARATRVNKRAPQMDWNRKREIFSNF
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgctggaatcgctgcggccccgcttgtgtcgcctggtgcgcggagagcaaggg
tacggctttcacctgcatggcgagaaaggccgccgtggccagttcatccggcgcgtggag
ccaggctccccagccgaggcggccgcgctgcgcgccggggaccgcctggttgaggtcaac
ggcgtcaacgtagagggcgagacgcatcaccaggtggtacagaggatcaaggctgtggag
gggcagacccagctgcttgtggtggacaaggagaccgatgaggagctctgccggcggcaa
ctgacctgcactgaggagatggcccatcgagggcttcccccagcccacaacccctgggag
ccaaagccggactgggcatgctcgggcagccttggctcggacactggccagaaggatgtc
aatgggcccccaagagagctgcgtccccggctctgccacttgcgaaggggaccccagggc
tacgggttcaacctgcatagtgacaagtcccggcctggccagtacatccgctctgtggac
cctggctctcctgcttctcactctggcctccgtgcccaggatcggctcattgaggtgaat
gggcagaacgtggaggggctgcgacatgccgaggttgtcgccagaatcaaggcacaggag
gacgaggcccggctgctggtagtcgatcctgagactgatgaacacttcaagcggttgagg
gtcatacccactgaggaacatgtagaaggtccactgccatcaccagtcacgaacgggacc
agtcctgcccagctcaatggtggctctgtgtgctcatcccgaagtgacctgccaggctca
gagaaggacaatgaggatggcagtacctggaagcgagaccccttccaggaaagtggcctc
cacctgagtcccacagcagctgaggccaaggagaaggctcgagctactcgggtcaacaag
cgggcaccacagatggactggaaccggaagcgagagatcttcagcaacttctga

DBGET integrated database retrieval system