KEGG   Mus musculus (mouse): 66082Help
Entry
66082             CDS       T01002                                 

Gene name
Abhd6, 0610041D24Rik, AA673485, AV065425
Definition
(RefSeq) abhydrolase domain containing 6
  KO
K13700  
abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
mmu  Mus musculus (mouse)
Pathway
Retrograde endocannabinoid signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Nervous system
   04723 Retrograde endocannabinoid signaling
    66082 (Abhd6)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     66082 (Abhd6)
Peptidases [BR:mmu01002]
 Serine Peptidases
  Family S33
   66082 (Abhd6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
UniProt: 
Position
14; 14 A1
AA seq 336 aa AA seqDB search
MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYAHHEDYQF
CYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLS
IVGQVKRIHQFVECLKLNKKPFHLIGTSMGGHVAGVYAAYYPSDVCSLSLVCPAGLQYST
DNPFVQRLKELEESAAIQKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHN
SFYRKLFLEIVNEKSRYSLHENMDKIKVPTQIIWGKQDQVLDVSGADILAKSISNSQVEV
LENCGHSVVMERPRKTAKLIVDFLASVHNTDNKKLN
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggatctcgatgtggttaacatgtttgtgattgcgggtgggaccctggccattccaatc
ctggcatttgttgcgtctttcctcctgtggccttcagcactgataagaatctattattgg
tactggcggaggacactgggcatgcaagttcgctacgcacaccatgaggactatcagttc
tgttactccttccggggcaggccaggacacaagccatccatccttatgctccatggattc
tccgcacacaaggacatgtggctcagcgtggtcaagttccttccgaagaacctgcacttg
gtctgtgtggacatgcctgggcatgaaggcaccacccgctcctccctggatgacctgtcc
atagtggggcaagttaaaaggatacatcagtttgtagaatgccttaagctgaacaaaaag
ccctttcaccttataggcacctccatgggtggccacgtggctggagtatatgccgcttac
tacccatctgatgtctgcagcctgtctctcgtgtgtcctgctggcctgcagtactcaact
gacaatccttttgtacaacggctcaaagagctggaggagtcagctgccattcagaagatt
cccttgatcccatccaccccggaagagatgagtgagatgctgcagctctgctcctatgtc
cgcttcaaggtgccccagcagatccttcaaggtcttgtcgatgttcgcattcctcataac
agcttctaccggaaattgtttttggaaatcgtcaatgagaaatccagatactctctgcat
gagaatatggacaagatcaaggtcccgacacagatcatttgggggaaacaagaccaggtg
cttgatgtgtccggggcagacatattagccaagtcaatctctaactcccaggtagaggtt
ctggaaaactgtggccattcggtagtgatggagagaccgaggaagacagccaagctcatt
gtcgactttttagcttctgtgcataacacagacaacaagaagctgaactga

DBGET integrated database retrieval system