KEGG   Mus musculus (mouse): 66124Help
Entry
66124             CDS       T01002                                 

Gene name
Josd2, 1110007C05Rik
Definition
Josephin domain containing 2 (EC:3.4.19.12)
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     66124 (Josd2)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C86
   66124 (Josd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7; 7 B2
AA seq 188 aa AA seqDB search
MSQAPEARPSPPSVYHERQRLELCAVHALNNVLQEQLFSQEAADEICKRLAPDSRLNPHR
SLLGTGNYDVNVIMAALQGLGLAAVWWDRRRPLSQLALPQVLGLILNLPSPVSLGLLSLP
LRRRHWVALRQVDGIYYNLDSKLRAPEALGDEDGVRTFLAAALAQGLCEVLLVVTKEVEE
AGCWLNTS
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaggctccggaagcaaggccgagtccaccctcagtgtatcatgagcggcagcgg
ctagagctgtgtgctgtccatgctctcaacaacgtccttcaagagcagctctttagccag
gaggctgccgacgaaatctgcaagaggctagccccagattcccggctgaacccccatcgc
agtctcttgggcaccggcaactatgatgtcaacgtgatcatggctgccctgcagggcctg
ggcctggccgctgtgtggtgggacaggaggagacccctgtcccagctggccctgccccag
gtactaggcctgatcttgaacctaccctctcctgtgtcgctggggctgctgtccctgcca
ctgcgccgccgacactgggtggccctgcgacaggtagatggcatctactataatctggac
tcaaagctccgggcccctgaagccctgggggacgaggatggagtcaggaccttcctggca
gctgccttggcccaaggcctgtgcgaggtgctattggtggtgaccaaggaggtggaggag
gccggctgctggctgaacacaagctga

DBGET integrated database retrieval system