KEGG   Mus musculus (mouse): 66315Help
Entry
66315             CDS       T01002                                 

Gene name
Senp7, 2410152H17Rik, 2810413I22Rik, 2900036C23Rik, 6030449K19Rik, AI790676
Definition
(RefSeq) SUMO1/sentrin specific peptidase 7 (EC:3.4.22.68)
  KO
K08596  
sentrin-specific protease 7 [EC:3.4.22.68]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.68  Ulp1 peptidase
     66315 (Senp7)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C48: Ulp1 endopeptidase family
   66315 (Senp7)
Ubiquitin system [BR:mmu04121]
 Deubiquitinating enzyme (DUB)
  UBL-specific proteases (ULPs)
   66315 (Senp7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
16; 16 C1.1
AA seq 1037 aa AA seqDB search
MDRARPGRRRASSEIVTEGKRKKSSPADLQKITKLLTVKSEDVLAQSPLSKLRGSECWWT
RSLRNKVICLDHKKPKAARGCPPKGLPKRHLRVMLTNVLWTDLGREFRKTLPRKDANLCA
PSKVQSDSLPSTSVDSIETCQRLDPLHQSLNLSERTPRVILTDIRQTELGRKYLKIPPVT
EASLSDTANLKSEQLSSSSDGSLESCQSVNHHKSFLSESGPKPSRTGDVPAKEAACGGQK
QGDDGGVTPEMAAPHPKDFNTGNKGCDYLEEGTSNKNTSYSYSEMDHTPVSRKRKKRGRS
NFHDSHNSKTSLDKPTEHTKEEENDSSVSRKLEESGEDSHQDPAPPEGLAPESLESEATN
LRSFAAGQEPDASAASGRASSPNKSLESSASSEVSENSSVAVKGEALTLKEASPPGGSSE
ESQLLISAEPIVVSSDEEGPVEHKNSVILKLQPPHEIMSENQGTSDPQLSELTLGACESV
QVTSELFPYNPDVENISCIKSNSEMDLKLDFIFTCVYIGKIKGTPKGCVTFTKKYIKIPF
QVSTNEISLTVDTARLKRFGLWESKDEDHSKRSHAILFLWLSSDYLQDIQTQLENPMLSQ
QSKANEFIFLELNSSISQREELKLKDIMMEISTKNGNLHLSCPLPWVQALPLFQDLSPQE
ISFLHYYYASASALPTAAGADMKKKSVSQPSNSDTIKPTYTFLHKQSSGCYSLSITSSPE
EEWQEVRNTGPVQKLIVYPPPPTKGGLGVTNEDLECLEEGEFLNDVIIDFYLKYLLLEKA
SDELVERSHIFSSFFYKCLTRKENNLTEDNPDLSVAQRRHRRVRTWTRHINIFNKDYIFV
PVNESSHWYLAVICFPWLEEAVYEDCPQTVSQQFQGQQSQHDHKMTDNDPHTTSTVSTSA
EDSQSTEVNMSVPKKMCKRPCILILDSLKAASIQNTVQNLREYLEVEWEVKRKTHREFSK
TNMVDLCPKVPKQDNSSDCGVYLLQYVESFFQDPIVNFELPIHLEKWFPRHVIKTKREDI
RELILKLHLQQQKGGSC
NT seq 3114 nt NT seq  +upstreamnt  +downstreamnt
atggacagggccaggcctgggcgtcggcgagcttcatcagagattgttacagagggaaaa
cggaaaaagtcatcaccagctgatttacagaagataacaaagttgttaactgtaaagtca
gaggatgttcttgctcagtcaccattgtccaaactcagaggctcagaatgctggtggaca
agaagcctaagaaataaagtcatctgtctagaccacaaaaaaccaaaagctgcccgtggg
tgtcctcctaagggattaccaaaaaggcatctcagagttatgttgacgaatgttctatgg
acggacttaggacgagaattcagaaagaccctgcctagaaaggatgctaatttatgtgct
cccagcaaggtgcaatcagactcattgccttcgacatctgttgacagcatagagacatgt
caaagattagatcctcttcaccaaagccttaatttatccgaaaggacacccagagttata
ctgacggatatccggcaaacagaattaggaagaaaatatttaaagatcccacctgtaact
gaggccagtttgagtgatacagccaacctgaaatcagagcaactttcttcatcatctgat
ggcagcttagagtcttgtcagagtgtaaatcatcacaagagctttttatctgaaagtggt
cccaaaccaagtaggacaggtgacgttcctgcaaaggaggctgcatgtgggggacagaag
cagggtgatgatggaggagtcactcctgagatggctgctcctcatcctaaagactttaat
actggaaataaaggttgtgattatcttgaagaggggaccagcaacaagaatacttcatat
tcttattcggaaatggaccatactccagtttccaggaagagaaagaaaaggggtagaagt
aattttcatgattctcataattctaagacttctttggataagccaacagaacatacaaaa
gaagaagaaaatgactcttcagtctcccgtaagcttgaagagtccggtgaagactctcac
caggacccagcaccacccgaaggactcgcgccagaatctttagagagcgaggccactaac
ctgcgctcattcgctgctggtcaggagccagatgctagcgctgcctctggaagggcctct
tcacccaacaaaagcttggagagctctgcttctagtgaagtgtcggagaattcttccgtg
gctgtgaagggtgaggcgttgactctaaaagaagcatcccctccgggtggaagcagtgaa
gagagccagttgttgatctcagctgagccaattgtagtttccagtgatgaagaaggaccg
gttgaacataagaattcagtaattctaaaattacagcctcctcatgagattatgagtgaa
aatcagggcacttctgacccacagttgtcagagctgacactcggtgcatgtgaatctgta
caggtaacatctgaattatttccatacaatcctgatgtagaaaacatttcctgtattaaa
tctaatagtgaaatggatctgaaattggatttcatatttacatgtgtgtatattggtaaa
ataaaaggaactccaaaaggttgtgtcacgttcacaaagaagtatattaaaatcccgttt
caagtgtccacaaatgagatttccctgacagtggacaccgcacgtttaaagaggttcggg
ttatgggaaagcaaggatgaggaccacagcaagaggagccacgctatccttttcctctgg
ctttcctcagactaccttcaagacattcagacccagctagaaaaccccatgctaagccag
caatcaaaagccaatgaatttattttccttgagttaaacagttccatttcacaaagagaa
gaattgaaattgaaagatattatgatggaaatcagtacaaaaaatggaaatttacacctg
tcttgtccattgccctgggtccaggcacttcctttgtttcaggatctctctccacaagaa
atctcttttcttcactattactatgcttcagcttctgctctccccactgctgctggggca
gacatgaagaagaagtcagtgtctcagccctcaaattcagacaccatcaagcctacttac
accttcctacataaacaaagtagtggttgctactcgctctctattacttcaagtccagag
gaggaatggcaggaagtcaggaacacgggacccgttcagaagttgattgtttatcctcca
ccacctactaagggaggcttgggagtaactaatgaagatctagagtgtttagaagaagga
gaatttcttaacgatgtaatcattgacttttaccttaagtatcttctattggagaaggca
tcagatgaacttgttgaacgaagtcacatttttagtagctttttctataaatgcttgaca
agaaaggaaaataatttaacagaagataatccagatctatcagtggctcagaggagacac
cgaagagtgagaacatggactcgtcatataaacatttttaataaagactacatctttgta
cctgttaatgaatcgtctcactggtatcttgcagtcatttgtttcccatggctagaagag
gctgtgtatgaagattgtccacaaactgtgtcccaacagttccagggtcagcagtctcag
catgaccacaaaatgacagataatgatccacataccacttcaactgtgtccacgagtgca
gaggattcccaaagtaccgaggtgaatatgtcagtaccaaagaaaatgtgtaagcggcca
tgtattctcatactagactccctgaaagctgcttctatacaaaacacagttcagaactta
cgagagtatttggaggtagagtgggaggtgaaacgaaaaacgcaccgtgaattcagtaaa
accaatatggtcgacctgtgccccaaagtccctaagcaggataacagcagtgactgtgga
gtctatttgttgcagtatgtggagagctttttccaggatcccattgttaactttgaactt
ccaattcacttggagaaatggtttcctcgccatgtaataaagaccaaacgggaagatatt
cgagagctcattttgaaacttcacttacagcaacagaagggcggcagctgctag

DBGET integrated database retrieval system