KEGG   Mus musculus (mouse): 66473Help
Entry
66473             CDS       T01002                                 

Gene name
Ctrb1, 2200008D09Rik, AI504462, Ctrb, Prt-2
Definition
chymotrypsinogen B1 (EC:3.4.21.1)
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Pancreatic secretion
Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    66473 (Ctrb1)
   04974 Protein digestion and absorption
    66473 (Ctrb1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.1  chymotrypsin
     66473 (Ctrb1)
Peptidases [BR:mmu01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   66473 (Ctrb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
8 E1; 8 57.98 cM
AA seq 263 aa AA seqDB search
MAFLWLVSCFALVGATFGCGVPAIQPVLTGLSRIVNGEDAIPGSWPWQVSLQDRTGFHFC
GGSLISENWVVTAAHCGVKTTDVVVAGEFDQGSDEENVQVLKIAQVFKNPKFNSFTVRND
ITLLKLATPAQFSETVSAVCLPTVDDDFPAGTLCATTGWGKTKYNALKTPDKLQQAALPI
VSEAKCKESWGSKITDVMICAGASGVSSCMGDSGGPLVCQKDGVWTLAGIVSWGSGFCST
STPAVYARVTALMPWVQEILEAN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcattcctttggcttgtgtcctgctttgcccttgtgggcgccacctttggctgtggg
gtccctgccatccaacccgtgctgaccggtctgtccaggatcgtcaacggagaggatgct
atccctggctcctggccctggcaggtgtccctgcaggacagaactggcttccatttctgc
gggggctccctcatcagcgaaaactgggtggtcactgctgcccactgcggggtcaagaca
accgatgtggtggtagctggagagtttgatcagggctccgatgaagagaatgtccaggtc
ctgaaaatcgctcaggtttttaagaaccccaagttcaactccttcaccgtgcgtaatgac
atcaccctgctgaagctggccactcctgcccagttctctgagactgtgtctgccgtgtgt
ctgcccactgttgacgatgacttccctgctgggacactgtgtgccaccactggctggggc
aagaccaaatacaatgccctcaagacccctgacaagctgcagcaggctgccctgcccatc
gtgtccgaggctaagtgcaaggagtcctggggttccaagatcaccgatgtgatgatctgc
gcaggcgccagtggcgtctcttcctgcatgggtgactctggtggccccctcgtctgccag
aaggacggagtctggaccctggcaggcattgtgtcctggggcagtggtttctgctccact
tccacccctgccgtgtatgcccgagtcactgccctcatgccctgggttcaggagatcttg
gaagccaactaa

DBGET integrated database retrieval system