KEGG   Mus musculus (mouse): 66473Help
Entry
66473             CDS       T01002                                 

Gene name
Ctrb1, 2200008D09Rik, AI504462, Ctrb, Prt-2
Definition
chymotrypsinogen B1 (EC:3.4.21.1)
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Pancreatic secretion
Protein digestion and absorption
Class
Organismal Systems; Digestive system; Pancreatic secretion [PATH:mmu04972]
Organismal Systems; Digestive system; Protein digestion and absorption [PATH:mmu04974]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
8 E1; 8 57.98 cM
AA seq 263 aa AA seqDB search
MAFLWLVSCFALVGATFGCGVPAIQPVLTGLSRIVNGEDAIPGSWPWQVSLQDRTGFHFC
GGSLISENWVVTAAHCGVKTTDVVVAGEFDQGSDEENVQVLKIAQVFKNPKFNSFTVRND
ITLLKLATPAQFSETVSAVCLPTVDDDFPAGTLCATTGWGKTKYNALKTPDKLQQAALPI
VSEAKCKESWGSKITDVMICAGASGVSSCMGDSGGPLVCQKDGVWTLAGIVSWGSGFCST
STPAVYARVTALMPWVQEILEAN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcattcctttggcttgtgtcctgctttgcccttgtgggcgccacctttggctgtggg
gtccctgccatccaacccgtgctgaccggtctgtccaggatcgtcaacggagaggatgct
atccctggctcctggccctggcaggtgtccctgcaggacagaactggcttccatttctgc
gggggctccctcatcagcgaaaactgggtggtcactgctgcccactgcggggtcaagaca
accgatgtggtggtagctggagagtttgatcagggctccgatgaagagaatgtccaggtc
ctgaaaatcgctcaggtttttaagaaccccaagttcaactccttcaccgtgcgtaatgac
atcaccctgctgaagctggccactcctgcccagttctctgagactgtgtctgccgtgtgt
ctgcccactgttgacgatgacttccctgctgggacactgtgtgccaccactggctggggc
aagaccaaatacaatgccctcaagacccctgacaagctgcagcaggctgccctgcccatc
gtgtccgaggctaagtgcaaggagtcctggggttccaagatcaccgatgtgatgatctgc
gcaggcgccagtggcgtctcttcctgcatgggtgactctggtggccccctcgtctgccag
aaggacggagtctggaccctggcaggcattgtgtcctggggcagtggtttctgctccact
tccacccctgccgtgtatgcccgagtcactgccctcatgccctgggttcaggagatcttg
gaagccaactaa

DBGET integrated database retrieval system