KEGG   Mus musculus (mouse): 665095Help
Entry
665095            CDS       T01002                                 

Gene name
Cyp2j8, Cyp2j8-ps, OTTMUSG00000007938
Definition
cytochrome P450, family 2, subfamily j, polypeptide 8
Orthology
K07418  
cytochrome P450, family 2, subfamily J [EC:1.14.14.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Arachidonic acid metabolism
Linoleic acid metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    665095 (Cyp2j8)
   00591 Linoleic acid metabolism
    665095 (Cyp2j8)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    665095 (Cyp2j8)
  Nervous system
   04726 Serotonergic synapse
    665095 (Cyp2j8)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    665095 (Cyp2j8)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     665095 (Cyp2j8)
Cytochrome P450 [BR:mmu00199]
 Cytochrome P450, animal type
  CYP2 family
   665095 (Cyp2j8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4 C5; 4
AA seq 503 aa AA seqDB search
MFATIGCLVSNICSEIHLWTLLLAALTLLLLVDYIKNRHPKNYPPGPWRLPFVGNLFQFD
LDVSHLHLGIQPFVKKYGNLISLDFGTIPSVIISGEPLIKEALTCMGQNFLKRPILAARQ
HIFKNNGIISSSGQTWKEQRRFTLMILKNFGLGKKSLEQRIQDEAHHLVEAIAEEKGRPF
DPHFMINNAVSNIICSITIGERFEYEDNQFQELLKLADETLCLEASKVLMLYNVFPSIFK
YLPGPHQKLFSNWEKLKLFFSHVMDSHRKDWNPSAPRDFIDAFLTEMAKYSDKTTTSFNE
ENLICTTLDLFFAGTETTSTALRWALLYITVNPEVQEKVHSEIDRVIGQGRHPTIDDRDS
MPYTNAVIHEVLRMGNIIPLNVPREVEADITLAGFHLPKGTMVLTNLTALHRDPKEWATP
DVFNPEHFLENGQFKKRESFLPFSVGKRGCPGEQLARSELFTFFTALMQKFTFKPPINEK
LSLNFKMGVALSPVSYCICAVPR
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgtttgctactataggttgcctggtgtctaacatctgctcagaaatccatctctggact
ctgctgctggctgctctcaccttgctgctcctggttgactacatcaaaaacaggcacccc
aagaactaccctcctggaccatggcgcctgccatttgtgggcaacttgtttcagtttgat
ttagatgtgtcacatctgcatttggggatccagccgtttgtgaagaagtatggaaaccta
attagcctggattttggtaccatcccttcagtgatcataagtggagaacccttaataaaa
gaagcattaacttgcatgggacagaactttttgaaacgccccattttagcggcaaggcaa
catatttttaaaaacaatggaattatttcctctagtggccaaacatggaaggaacaaaga
aggttcacactgatgatactcaagaattttggattagggaagaaaagcttagaacaacgc
atacaggatgaggctcaccatcttgtggaagccatagcagaggagaaaggacggcctttt
gaccctcacttcatgatcaataatgcagtttccaatatcatttgttccatcactattggg
gaacgttttgagtatgaagacaatcagtttcaggagctactgaagttagcagatgagacc
ctgtgtttggaggcatcaaaggtgttaatgctctacaatgtctttccatctatatttaaa
tatcttcctggaccacatcaaaaacttttcagcaactgggaaaaactgaaattgtttttt
tcccatgtgatggacagtcaccggaaagattggaatccttctgcaccaagagacttcatt
gatgctttccttacagaaatggcaaagtactcagacaagacaactacaagttttaatgaa
gaaaatctcatctgcaccactctggacctcttctttgctggaacagagacaacatccaca
gcactgcgttgggctctgctctacataactgttaatccagaagtgcaagaaaaagtacac
tctgagattgacagagtgattggccaagggagacacccaaccatagatgaccgagactcc
atgccctacaccaatgctgtcatccatgaggtactgaggatgggtaacatcatccctttg
aatgttcccagggaagtagaagctgatatcacactggccggattccacctgcctaagggc
accatggttttgaccaatctgactgctcttcatagggaccccaaagagtgggccactcca
gatgtctttaatccagagcactttttggagaatggtcagtttaagaagagagaatctttt
ctaccattctcagtgggaaagagaggttgccctggagaacaactagcaagatctgaactg
ttcacgttcttcactgctcttatgcaaaaatttaccttcaagcccccaatcaatgagaag
ctgagcctgaatttcaaaatgggcgtcgctctttccccagtcagctattgcatctgtgct
gtacctagataa

  All links  
No link information was found.   
DBGET integrated database retrieval system