KEGG   Mus musculus (mouse): 665270Help
Entry
665270            CDS       T01002                                 

Gene name
Plb1, 4632413E21Rik, 4930433E17Rik, 4930539A06Rik, BC033606
Definition
phospholipase B1 (EC:3.1.1.5 3.1.1.4)
Orthology
K14621  
phospholipase B1, membrane-associated [EC:3.1.1.4 3.1.1.5]
Organism
mmu  Mus musculus (mouse)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Vitamin digestion and absorption
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:mmu00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:mmu00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:mmu00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:mmu00591]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:mmu00592]
Organismal Systems; Digestive system; Vitamin digestion and absorption [PATH:mmu04977]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5 B1; 5
AA seq 1478 aa AA seqDB search
MELYPGVSPVGLLLLLLLGQGPSQIHGSSGENTLAWQSQQVFWTLKNFPFPCKPKKLELS
VLSESVHSLRPSDIKLVAAIGNPEIPLAPGSGTINMEKPQSIKNQPQDVCMGIMTVLSDI
IRHFSPSVLMPTCSPGKGTAVHTTAEDLWIQAKELVRRLKDNPQLDFEKDWKLITVFFSN
TSQCHLCPSAQQKSHLMRHMEMLWGVLDYLHHEVPRAFVNLVDLSEVLAMDLQHQETGFS
PAPEVCKCTETTTLSKAVMQWSYQEAWEDLLASSKFNKHETFAVVFQPFFDEIEPPLKRS
SPQDPTTLALRIWNSMMEPVGQKDGLLNTAERKTMKCPSEESPYLFTYKNSNYQARRLKP
ITKLQMKEGSEFTCPDKNPSNSIPTTVHSLRPADIKIIGALGDSLTAGNGAGASPWNILD
VLTEYRGLSWSVGGDETIKTVTTLPNILREFNPSLKGFSVGTGKESTSRASFNQAVAGAK
SDGLAGQARKLVDLMKADKTINFQEDWKIITVFIGGNDLCASCSNSTRFSPQNFIDNIKN
ALDILHAEVPRAFVNMAMVMEITPLRELFNEPTVSCPRNILSRLCPCVLGLGDNSEELSS
LVQRNRDYQKKTEELINSGRYDTRDNFTVVVQPLFENVSMPRTPEGVPDKSFFAPDCFHF
NAKTHARSAIALWKNMLEPVGHKTRHNNFEIKAPIVCPNQASPFLSTTKNSNLGNGTWMV
CEERAPSASPPTSVHTLRPADIQVVAALGDSLTAGNGISSQEGNLTDVSTQYRGLSYSAG
GDKTLENVTTLPNILRKFNGNLTGYSVGTGDSSSANAFLNQAVPGAKAENLTSQVRTLVQ
KMKSDNRVNFNRDWKVITVMIGASDLCDFCTDSNHYSAANFFDHLQNALDILHKEVPRAL
VNLVDFINPSIIREVFLKNPDKCPVNQSSVLCNCVLTPRKDSYELARLEAFTKSYQSSML
QLVESGRYDTREDFSVVLQPFLLNTKLPVLENGKPDTSFFAPDCIHLNQKFHTQLARALW
ANMLEPLGKKTDTLDPKGHISLACPTKDQPFLRTFRNSNYKYPTKPAIENWGSDFLCTEK
SPSSQVPTSVHELRPADIKVVAAMGDFLTTATGARPSGYKRLATPWRGLSWSIGGDGKLE
THTTLPNILKKFNPSITGFSTGTLDNKAGLNVAEEGARAQDMPAQAKTLVKKMKSTPTIN
LQEDWKLITLLIGNNDLCLYCENPEDNSTKEYVKYIQQALDILYEELPRVFINVVEVMEL
AGLHHVQGGKCAMPLAVQKNCSCLRHSQNLTAMQELKKLNWNLQSGISELSYWHRYMERE
DFAVTVQPFFRNTFIPLNEREGLDLTFFSEDCFYFSDRGHAEMAIALWNNMLEPVGWKTS
SNNFIYNRTKLKCPSPERPFLYTLRNSQLLPDKAEEPSNALYWAVPVAAIGGLAVGILGV
MLWRTVKPVQQEEEEEDTLPNTSVTQDAVSEKRLKAGN
NT seq 4437 nt NT seq  +upstreamnt  +downstreamnt
atggagctgtacccaggtgtgtccccggtgggactgctgctgctgctactgctgggacaa
gggccctcccaaatccatggctcttctggagagaacacattggcatggcagtcccagcaa
gtgttttggaccctgaagaattttccattcccttgcaagccaaagaagttagaattgagt
gtgctttctgagtcagttcactctctgagaccctcagacattaaactcgtggcagccatc
ggcaacccagaaattcctctagcccctgggtctggcacgatcaacatggagaaacctcaa
agcatcaagaaccaaccacaggatgtatgcatgggaatcatgacagttctttcagatatc
atcagacatttcagtccttctgtcctgatgcccacgtgttctcctgggaagggcactgca
gtccacactactgctgaagatttgtggattcaggctaaagagctggtgaggcgcctgaag
gacaacccgcaacttgactttgagaaggactggaaactcatcactgtgttcttcagtaac
acaagccagtgtcacctgtgtccctctgctcagcagaaaagtcacttgatgaggcacatg
gagatgctgtggggggtgctggattacctgcatcatgaggtccccagagcatttgtgaat
ttggtggatctctctgaggttttggccatggatcttcagcatcaagagactggcttcagc
cctgcaccagaggtttgcaaatgcacagagacaacgacgctatccaaagctgtcatgcag
tggtcctatcaggaagcctgggaagatcttctggcctctagcaagttcaacaagcatgag
accttcgcggtggttttccagcctttcttcgatgaaattgaaccacccttgaaaaggtcc
tcgccccaggatcccaccacactcgccctcaggatctggaatagcatgatggaaccagtg
ggtcaaaaggatgggctactcaatactgcagagagaaagacaatgaaatgtccctctgag
gagagtccctatctgttcacctacaaaaatagcaactaccaggccagacgactgaaacct
ataacaaagcttcagatgaaagaaggatcagaattcacctgtcctgacaagaacccctcg
aactcaatccccacaacagttcacagcttgcggccagctgatatcaagatcataggagca
ttgggtgactcgctcacggcaggcaatggagctggggccagcccttggaatatcttggat
gtcttaactgaataccgaggcctgtcctggagtgtgggcggggatgagaccatcaaaacc
gtgaccaccctacccaacattctccgggaattcaacccctccttgaagggcttttctgtt
ggcactgggaaagaaagcacttcccgagcatccttcaaccaggccgtagcaggagccaaa
tctgatggcttagctggccaggccagaaagctggtggacctgatgaaggcagacaagaca
ataaactttcaggaagactggaagataatcactgtgtttataggaggcaatgacctctgt
gcttcctgcagtaactcgactcgcttttctccccaaaacttcatagacaacatcaagaac
gccctggacatcctccatgcagaggttccacgggcctttgtgaacatggcaatggtgatg
gagatcacccccttgagagaactattcaatgaacctacagtctcatgcccacggaacatc
ctcagccgactgtgtccttgtgtcctgggccttggtgataactcagaagaactttccagc
ctcgttcaaaggaacagggattatcagaagaaaactgaagagctcattaatagcggacga
tatgacacgagggataatttcactgtggttgtccagcccttatttgaaaatgtgtccatg
ccacggaccccggagggcgtgcccgacaagtctttctttgcccctgactgtttccacttt
aatgccaagactcatgcccgctcagccattgccctctggaagaacatgctggaacctgtg
ggccacaagacaagacataataattttgaaatcaaggcccctatcgtgtgtccgaaccag
gcctcgccatttctgagcactaccaagaacagcaacctgggtaatggaacctggatggtg
tgcgaggagagagccccttctgcctcaccaccaacctcagtgcataccctgagacctgca
gacattcaagttgtggcagctctgggagactctctgactgctggcaatggaatcagctcc
caagaaggtaacctcaccgatgtctccacacagtatcgaggactgtcctatagtgctggt
ggggacaagaccctggagaatgtgaccactttgcccaatatcctacggaaatttaatgga
aatctcacaggctactcagtaggaaccggtgactccagttccgcaaacgctttccttaac
caggctgtccctggggcgaaggctgagaaccttacaagccaagtccggactctggttcag
aagatgaagagtgacaacagagtgaacttcaaccgagactggaaggtcatcacggtgatg
atcggcgccagtgacttgtgtgacttctgcacggattcgaatcattactctgcagccaat
ttttttgaccatctccaaaatgccttggacattctacataaggaggtacccagagccctg
gtcaaccttgtggacttcattaaccccagtatcattcgggaagtattcctgaagaaccca
gacaagtgcccagtgaatcagtccagtgtcctgtgcaactgtgttctgaccccgaggaag
gattcctatgagctggcaaggttggaggccttcaccaaatcctaccagagtagcatgctc
caactggttgagtcaggccgctacgacactcgagaggacttctctgtggtactgcagccc
tttctcctcaacaccaagctccctgtcctagagaacgggaaaccagatacatccttcttt
gccccagactgcatccacctaaaccagaagttccacactcagctcgcgagagccctctgg
gccaatatgcttgaacccctgggaaagaaaactgatactttggacccaaaaggacacata
tctttggcctgccccaccaaggatcagcccttcctgagaaccttccgaaacagtaactac
aagtatcctaccaagccagccattgagaactggggcagtgacttcctgtgcacagagaag
agcccttccagccaggtacccacctcagttcatgagctccgaccagcagacatcaaggtg
gtggcagcaatgggtgactttctgactacagccaccggagctcggccaagtggatataaa
aggctagccacgccctggagggggctgtcttggagcattggaggagatggaaagttggag
acccataccacacttcccaacatcctgaagaagttcaacccttccatcactggattctct
actggtaccctggacaacaaggcaggattaaatgtggcagaagaaggagccagagctcag
gacatgccggcccaggctaagaccctggtgaagaagatgaaaagcacacctacaatcaac
ctacaggaagactggaagctgattacactcctcattggaaacaacgacctgtgtctttac
tgtgagaatccggaggacaactcaactaaagagtatgtcaagtacatccagcaagccttg
gacatcctctatgaggagcttcccagagttttcatcaatgtggtggaagtcatggagctg
gctggcctgcaccacgtccaaggtgggaaatgtgccatgccactggcagttcagaaaaac
tgcagttgcttaagacactcccaaaacctcacagcgatgcaggagctgaagaaactaaac
tggaacctccagagcggcatctccgagctctcctattggcaccggtacatggagcgtgag
gacttcgcagtcactgtgcagcctttcttccggaatacctttatcccactgaatgagcgt
gagggcctggacctcactttcttctctgaagactgtttctacttctcagaccgtgggcat
gctgagatggccattgccctctggaataacatgctggaaccagtgggctggaagacatcc
tccaataacttcatatacaacagaaccaaactcaagtgcccctcacctgaaaggcctttc
ctctacaccctccggaatagtcagcttcttccagacaaggctgaagaaccctccaatgca
ctctactgggcagtgccagtggcagcaataggtggcctggcagttggcatccttggagtg
atgttgtggagaactgtgaaacccgtccaacaggaggaggaggaggaggacactcttcca
aatacaagtgtgacccaggatgctgtatcagaaaagaggctcaaagctgggaactag

DBGET integrated database retrieval system