KEGG   Mus musculus (mouse): 66645Help
Entry
66645             CDS       T01002                                 

Gene name
Pspc1, 5730470C09Rik, AI327109, AI449052, PSP1
Definition
(RefSeq) paraspeckle protein 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
14; 14 C3
AA seq 523 aa AA seqDB search
MMLRGNLKQVRIEKNPARLRALESAAGESEPVAAAAMALTLAGEQAPPPAPSEEHPDEEL
GFTIDIKSFLKPGEKTYTQRCRLFVGNLPTDITEEDFKRLFERYGEPSEVFINRDRGFGF
IRLESRTLAEIAKAELDGTILKSRPLRIRFATHGAALTVKNLSPVVSNELLEQAFSQFGP
VEKAVVVVDDRGRATGKGFVEFAAKPPARKALERCGDGAFLLTTTPRPVIVEPMEQFDDE
DGLPEKLMQKTQQYHKEREQPPRFAQPGTFEFEYASRWKALDEMEKQQREQVDRNIREAK
EKLEAEMEAARHEHQLMLMRQDLMRRQEELRRLEELRNQELQKRKQIQLRHEEEHRRREE
EMIRHREQEELRRQQEGGFKPNYMENREQEMRMGDMGPRGAINMGDAFSPAPAGTQGPPP
MMGMNMNNRGTIPGPPMGPGPAMGPEGAANMGTPMIPDNGAVHNDRFPQGPPSQMGSPMG
NRTGSETPQAPMSGVGPVSGGPGGFGRGSQGGNFEGPNKRRRY
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgatgttaagaggaaacctgaagcaagtacgtattgagaaaaacccggctcgtcttcgc
gccctggagtcggcggccggagagagcgaaccggtggccgcggcggccatggcgctgacg
ctggccggcgagcaggcgccgccacccgcaccttccgaggagcacccggacgaggaattg
ggcttcaccatcgacatcaagagtttcctcaagccgggcgagaagacgtacacgcagcgc
tgccgcctcttcgtgggtaacctgcccacagacatcacggaggaggacttcaagcgcctc
tttgagcgctacggagagcccagcgaggtcttcatcaaccgcgaccgaggcttcggcttc
atccgcctggaatcgagaacactggctgaaattgcaaaagcagagttggatggcaccata
ctgaagagcagacctctccgaattcgctttgctacacatggagcagccctaacggtcaag
aacctttctccggttgtttccaatgagcttctagagcaagcattttcccagtttggccca
gtagagaaagctgttgtggttgtggatgatcgtggtagagccacaggaaaaggttttgta
gaatttgcagcgaaacctcctgcacgaaaggctctggagagatgtggtgatggggcgttc
ttgctaacaacaacacctcgtccagtcattgtagaacccatggagcagtttgatgatgaa
gatggtttaccagagaagctaatgcagaaaactcaacagtaccataaggaaagagaacag
ccaccacggtttgctcaacctgggacatttgaatttgaatatgcgtctcgatggaaggct
cttgatgaaatggaaaagcagcagcgggaacaagttgatagaaacatcagagaagccaaa
gagaaactggaggcagagatggaagcagctagacatgaacaccagttaatgctaatgagg
caagatctaatgagacgtcaagaagaactcagacgtttggaagaactcagaaatcaagaa
ctgcagaaacgaaagcaaatacaactgagacacgaagaagagcatcgtcgtcgtgaagaa
gaaatgatccgtcacagagagcaggaggagctgaggcgacagcaagagggcggctttaaa
ccaaactatatggaaaatagagaacaggaaatgagaatgggtgatatgggtccccgtgga
gcaataaacatgggagatgcatttagcccagcacctgctggtacccaaggtcctcctcca
atgatgggtatgaatatgaacaacagaggaactatacctggcccaccaatgggtcctggt
cctgccatgggaccagaaggagctgcaaatatgggaactccaatgataccagataatggc
gcagtgcacaatgataggtttccccaaggacctccatcccagatgggttcacccatggga
aatagaacaggttctgaaactccccaggcaccgatgagtggtgtagggcctgtaagtggt
ggtcctggcggctttggtagagggagtcaagggggcaattttgaaggccctaataagcgt
cggagatattaa

DBGET integrated database retrieval system