KEGG   Mus musculus (mouse): 66656Help
Entry
66656             CDS       T01002                                 

Gene name
Eef1d, EF-1-delta
Definition
(RefSeq) eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein)
  KO
K15410  
elongation factor 1-delta
Organism
mmu  Mus musculus (mouse)
Pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    66656 (Eef1d)
Translation factors [BR:mmu03012]
 Eukaryotic Type
  Elongation factors
   66656 (Eef1d)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
15; 15 E1
AA seq 281 aa AA seqDB search
MATNFLAHEKIWFDKFKYDDAERRFYEQMNGPVTSGSRQENGASVILRDIARARENIQKS
LAGSSGPGASSGPGGDHSELIVRITSLEVENQNLRGVVQDLQQAISKLEARLSSLEKSSP
TPRATAPQTQHVSPMRQVEPPTKKGATPAEDDEDKDIDLFGSDEEEEDKEAARLREERLR
QYAEKKAKKPTLVAKSSILLDVKPWDDETDMAQLETCVRSIQLDGLVWGASKLVPVGYGI
RKLQIQCVVEDDKVGTDLLEEEITKFEEHVQSVDIAAFNKI
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggctacaaactttctagcgcatgagaagatctggtttgacaagtttaaatatgatgat
gcagaaaggagattctatgagcagatgaacgggcctgtgacctccggctcccgccaggag
aatggtgccagcgtgatcctccgagacattgcaagagccagagagaacatccagaaatcc
ttggctggaagctcaggccctggagcctccagtggacctggtggagaccacagtgagctc
attgtgaggattaccagtctggaagtggagaaccagaaccttcgaggcgtggtgcaagat
ttgcagcaggccatttccaagttggaggcccggctgagctctctagagaagagttcacct
actccccgagccacggccccacagacccaacatgtctctcctatgcgtcaagtggagccc
ccaaccaagaaaggagccacaccagcagaggacgatgaggacaaggacattgacctgttc
ggcagtgacgaggaggaagaagataaggaggctgcccgactacgggaggagaggctacgc
cagtacgcagagaagaaggccaagaagcccacactggtggccaaatcctccatccttttg
gatgttaaaccttgggatgatgagactgacatggcccagctagagacttgtgtgcgttcc
atccaattggacgggctggtttggggggcctccaagcttgtgcctgttggctatggcatc
cggaagctgcagatccagtgtgtggtggaggatgacaaagtgggcaccgacttgctcgag
gaggagatcaccaaatttgaggagcatgtgcagagtgtcgacatcgcagctttcaacaag
atctga

DBGET integrated database retrieval system