KEGG   Mus musculus (mouse): 66671Help
Entry
66671             CDS       T01002                                 

Gene name
Ccnh, 6330408H09Rik, AI661354, AV102684, AW538719
Definition
cyclin H
Orthology
K06634  
cyclin H
Organism
mmu  Mus musculus (mouse)
Pathway
Basal transcription factors
Nucleotide excision repair
Cell cycle
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:mmu03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:mmu03420]
Cellular Processes; Cell growth and death; Cell cycle [PATH:mmu04110]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
13 C3; 13
AA seq 323 aa AA seqDB search
MYHSSSQKRHWTFASEEQLARLRADANRKFKCKAVANGKVLPNDPVFLEPHEELTLCKYY
EKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNV
SSPQFVGNLRESPLGQERALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDIKTRYPM
LENPEILRKTADDFLSRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKE
NRTCLSQLLDIMKSMRNLVKKYEPPRSDEVAVLKQKLERCHSSDLALNAVTKKRKGYEDD
DYVSKKPKQEEEEWTDDDLVDSL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtatcacagcagcagccagaaacggcactggaccttcgctagcgaggagcagctggcg
cgcctgcgggcggacgccaaccgcaaattcaagtgcaaagctgtggctaacgggaaggtt
cttccaaatgatccagtgtttctggagcctcatgaagaattgacactttgcaagtactat
gaaaaaagattattggaattctgttcagtgtttaaaccagctatgccacggtctgttgtg
ggtacagcttgtatgtatttcaagcgtttttatcttaataactcagtaatggaatatcac
cctcggataataatgcttacttgtgcatttttggcctgcaaagtagatgaattcaatgtg
tctagtccccagtttgttggaaatcttcgagagagtcctcttggacaggagagggcactg
gaacagattttggaatatgaactactacttatacaacaacttaattttcaccttattgtc
cacaatccatacagaccatttgaaggcttcctcatcgatataaagactcggtaccccatg
ttggagaatccggagattctgaggaaaacagctgatgattttcttagtagaattgcattg
acagatgcttatcttttatacacaccttcacagattgccctgaccgccattttatcaagt
gcctctagagctggaattactatggaaagctacttatcagagagtctaatgctaaaagaa
aacagaacttgcctgtcacagttactggatataatgaaaagcatgagaaatctagtaaaa
aagtacgagccgcccaggtctgacgaggttgctgtcctgaaacagaagctggagcggtgt
cattcttctgaccttgcacttaatgcggttacgaagaagaggaaaggctatgaagatgat
gactatgtgtcaaagaaacccaaacaggaagaggaggaatggactgatgacgacctggta
gattctctctaa

DBGET integrated database retrieval system