KEGG   Mus musculus (mouse): 66671Help
Entry
66671             CDS       T01002                                 

Gene name
Ccnh, 6330408H09Rik, AI661354, AV102684, AW538719
Definition
(RefSeq) cyclin H
  KO
K06634  cyclin H
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03022  Basal transcription factors
mmu03420  Nucleotide excision repair
mmu04110  Cell cycle
Module
mmu_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    66671 (Ccnh)
  Replication and repair
   03420 Nucleotide excision repair
    66671 (Ccnh)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    66671 (Ccnh)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     66671 (Ccnh)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     66671 (Ccnh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_C_2 Cyclin_N Cyclin_C UBA2_C
Motif
Other DBs
NCBI-GeneID: 66671
NCBI-ProteinID: NP_075732
MGI: 1913921
Ensembl: ENSMUSG00000021548
Vega: OTTMUSG00000035504
UniProt: Q61458
Position
13; 13 C3
AA seq 323 aa AA seqDB search
MYHSSSQKRHWTFASEEQLARLRADANRKFKCKAVANGKVLPNDPVFLEPHEELTLCKYY
EKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNV
SSPQFVGNLRESPLGQERALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDIKTRYPM
LENPEILRKTADDFLSRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKE
NRTCLSQLLDIMKSMRNLVKKYEPPRSDEVAVLKQKLERCHSSDLALNAVTKKRKGYEDD
DYVSKKPKQEEEEWTDDDLVDSL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtatcacagcagcagccagaaacggcactggaccttcgctagcgaggagcagctggcg
cgcctgcgggcggacgccaaccgcaaattcaagtgcaaagctgtggctaacgggaaggtt
cttccaaatgatccagtgtttctggagcctcatgaagaattgacactttgcaagtactat
gaaaaaagattattggaattctgttcagtgtttaaaccagctatgccacggtctgttgtg
ggtacagcttgtatgtatttcaagcgtttttatcttaataactcagtaatggaatatcac
cctcggataataatgcttacttgtgcatttttggcctgcaaagtagatgaattcaatgtg
tctagtccccagtttgttggaaatcttcgagagagtcctcttggacaggagagggcactg
gaacagattttggaatatgaactactacttatacaacaacttaattttcaccttattgtc
cacaatccatacagaccatttgaaggcttcctcatcgatataaagactcggtaccccatg
ttggagaatccggagattctgaggaaaacagctgatgattttcttagtagaattgcattg
acagatgcttatcttttatacacaccttcacagattgccctgaccgccattttatcaagt
gcctctagagctggaattactatggaaagctacttatcagagagtctaatgctaaaagaa
aacagaacttgcctgtcacagttactggatataatgaaaagcatgagaaatctagtaaaa
aagtacgagccgcccaggtctgacgaggttgctgtcctgaaacagaagctggagcggtgt
cattcttctgaccttgcacttaatgcggttacgaagaagaggaaaggctatgaagatgat
gactatgtgtcaaagaaacccaaacaggaagaggaggaatggactgatgacgacctggta
gattctctctaa

DBGET integrated database retrieval system