KEGG   Mus musculus (mouse): 66671Help
Entry
66671             CDS       T01002                                 

Gene name
Ccnh, 6330408H09Rik, AI661354, AV102684, AW538719
Definition
cyclin H
Orthology
K06634  
cyclin H
Organism
mmu  Mus musculus (mouse)
Pathway
Basal transcription factors
Nucleotide excision repair
Cell cycle
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    66671 (Ccnh)
  Replication and repair
   03420 Nucleotide excision repair
    66671 (Ccnh)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    66671 (Ccnh)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     66671 (Ccnh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
13 C3; 13
AA seq 323 aa AA seqDB search
MYHSSSQKRHWTFASEEQLARLRADANRKFKCKAVANGKVLPNDPVFLEPHEELTLCKYY
EKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNV
SSPQFVGNLRESPLGQERALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDIKTRYPM
LENPEILRKTADDFLSRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKE
NRTCLSQLLDIMKSMRNLVKKYEPPRSDEVAVLKQKLERCHSSDLALNAVTKKRKGYEDD
DYVSKKPKQEEEEWTDDDLVDSL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtatcacagcagcagccagaaacggcactggaccttcgctagcgaggagcagctggcg
cgcctgcgggcggacgccaaccgcaaattcaagtgcaaagctgtggctaacgggaaggtt
cttccaaatgatccagtgtttctggagcctcatgaagaattgacactttgcaagtactat
gaaaaaagattattggaattctgttcagtgtttaaaccagctatgccacggtctgttgtg
ggtacagcttgtatgtatttcaagcgtttttatcttaataactcagtaatggaatatcac
cctcggataataatgcttacttgtgcatttttggcctgcaaagtagatgaattcaatgtg
tctagtccccagtttgttggaaatcttcgagagagtcctcttggacaggagagggcactg
gaacagattttggaatatgaactactacttatacaacaacttaattttcaccttattgtc
cacaatccatacagaccatttgaaggcttcctcatcgatataaagactcggtaccccatg
ttggagaatccggagattctgaggaaaacagctgatgattttcttagtagaattgcattg
acagatgcttatcttttatacacaccttcacagattgccctgaccgccattttatcaagt
gcctctagagctggaattactatggaaagctacttatcagagagtctaatgctaaaagaa
aacagaacttgcctgtcacagttactggatataatgaaaagcatgagaaatctagtaaaa
aagtacgagccgcccaggtctgacgaggttgctgtcctgaaacagaagctggagcggtgt
cattcttctgaccttgcacttaatgcggttacgaagaagaggaaaggctatgaagatgat
gactatgtgtcaaagaaacccaaacaggaagaggaggaatggactgatgacgacctggta
gattctctctaa

DBGET integrated database retrieval system